[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00427.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2bsqH.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2bsqE.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "3csuA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2dwuB.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2a5vC.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "2dwuA.bssp"

## Summary of PDB Search
:248
    1e-42  17%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-40  25%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-38  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    3e-38  12%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-37  13%  3cmvH  [x.x.x] PROTEIN RECA
    1e-36  26%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-36   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-36  13%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    5e-36  15%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    5e-35   9%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-34   9%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-34   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-34  11%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-34  11%  3cmvG  [x.x.x] PROTEIN RECA
    5e-34   8%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-33   9%  2bifA  [c.37.1 - c.60.1] PROTEIN
    1e-33  13%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-33  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-33   8%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-33   9%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-33  10%  2akaB  [x.x.x] DYNAMIN-1
    8e-33  19%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-32  10%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    8e-32  13%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-31  12%  3cmvC  [x.x.x] PROTEIN RECA
    2e-31  10%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-31   9%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    4e-31   7%  1e98A  [c.37.1] THYMIDYLATE KINASE
    5e-31  21%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-31  10%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-30  10%  2cgtH  [x.x.x] 60 KDA GROEL
    3e-30  11%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    3e-30  10%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    2e-29  10%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-29  13%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-29  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    8e-29  13%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    3e-28  10%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    3e-28   8%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    4e-28  28%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-28   8%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-27   9%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-27  36%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-27  15%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-26  14%  3cmvA  [x.x.x] PROTEIN RECA
    1e-26  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    1e-26  33%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-26  11%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    8e-26  10%  2cckA  [x.x.x] THYMIDYLATE KINASE
    1e-25  11%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-25  16%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    1e-25  10%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-25  10%  4dcgA  [x.x.x] VP39
    2e-25  13%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-25  14%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-25  10%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-25  18%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-25   9%  3da4A  [x.x.x] COLICIN-M
    2e-25  14%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-25   8%  1aroP  [e.8.1] T7 RNA POLYMERASE
    3e-25  34%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-25  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    7e-25  13%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-25  31%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-25  34%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    9e-25  11%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    1e-24  10%  2ctsA  [x.x.x] CITRATE SYNTHASE
    2e-24  13%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-24   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-24  11%  2b8tB  [x.x.x] THYMIDINE KINASE
    3e-24  14%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-24  11%  3cmxA  [x.x.x] PROTEIN RECA
    4e-24  17%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    4e-24  13%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    4e-24  12%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    5e-24  11%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-23  11%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-23  14%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-23  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    1e-23  10%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-23   6%  2c0bL  [x.x.x] RIBONUCLEASE E
    2e-23  10%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-23   6%  2axzC  [x.x.x] PRGX
    3e-23  16%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-23   8%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    5e-23  10%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    5e-23  10%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    6e-23   7%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    6e-23  11%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-23  10%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    7e-23  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-23   9%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    8e-23  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    8e-23  18%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-22  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  11%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-22  11%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    2e-22  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-22   8%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    3e-22  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    3e-22  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-22  19%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-22   7%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-22   8%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    1e-21  11%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-21  14%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    1e-21  12%  1e0jA  [c.37.1] DNA HELICASE
    1e-21  10%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    1e-21  11%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-21  11%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-21  22%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-21  10%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    2e-21   9%  3adkA  [x.x.x] ADENYLATE KINASE
    2e-21  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-21   8%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    2e-21  10%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-21  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-21  31%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-21  10%  2bx2L  [x.x.x] RIBONUCLEASE E
    4e-21  11%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    4e-21  13%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-21   6%  2c4rL  [x.x.x] RIBONUCLEASE E
    7e-21  12%  1e0jB  [c.37.1] DNA HELICASE
    8e-21  12%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-21  12%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    8e-21  11%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-21  16%  3c8uA  [x.x.x] FRUCTOKINASE
    9e-21  11%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-20   7%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-20  13%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    1e-20  11%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-20  11%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-20  11%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-20  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-20  13%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    2e-20  11%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    2e-20   9%  2bhvD  [x.x.x] COMB10
    2e-20  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    2e-20  11%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-20   8%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    3e-20  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-20   5%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    4e-20  10%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    4e-20   9%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    4e-20  13%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-20  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    5e-20  18%  2d2fA  [x.x.x] SUFC PROTEIN
    5e-20  11%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    5e-20  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    6e-20   7%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    6e-20  11%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-20  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    7e-20   9%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    7e-20  12%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    8e-20   8%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    9e-20  12%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-19  11%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-19  11%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-19  12%  3cm0A  [x.x.x] ADENYLATE KINASE
    1e-19  13%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-19  11%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-19  11%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-19  12%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    3e-19  10%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-19  11%  2b8tC  [x.x.x] THYMIDINE KINASE
    4e-19   7%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    4e-19  11%  3cmvE  [x.x.x] PROTEIN RECA
    4e-19  13%  2bdtA  [x.x.x] BH3686
    4e-19   9%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    5e-19  15%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    5e-19   7%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    7e-19  13%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-19  11%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-19  11%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    9e-19  11%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-18  10%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-18  11%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    2e-18  11%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-18  11%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    5e-18  10%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-18   8%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-18   7%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    6e-18   5%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    6e-18  12%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-18   9%  2a1fF  [x.x.x] URIDYLATE KINASE
    7e-18   7%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    8e-18  10%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    9e-18  28%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-17  12%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-17  12%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-17  10%  2c9oC  [x.x.x] RUVB-LIKE 1
    1e-17  16%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-17  15%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-17   9%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-17  12%  2ancF  [x.x.x] GUANYLATE KINASE
    2e-17  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    2e-17  12%  2bhvA  [x.x.x] COMB10
    3e-17  11%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    3e-17  11%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-17  20%  1e2iB  [c.37.1] THYMIDINE KINASE
    4e-17  12%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-17  12%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    5e-17  13%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    5e-17  10%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    6e-17  12%  3cmtD  [x.x.x] PROTEIN RECA
    7e-17  12%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    8e-17  12%  3ec1A  [x.x.x] YQEH GTPASE
    9e-17  10%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-16   9%  1e2iA  [c.37.1] THYMIDINE KINASE
    1e-16  12%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-16  12%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-16   9%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    1e-16  12%  1adoA  [c.1.10] ALDOLASE
    1e-16  13%  2anbA  [x.x.x] GUANYLATE KINASE
    1e-16   7%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    1e-16  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-16  11%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16  10%  3be4A  [x.x.x] ADENYLATE KINASE
    2e-16  11%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16  12%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16  16%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-16  13%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    3e-16  12%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-16  12%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-16   8%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    3e-16  10%  1e2nA  [c.37.1] THYMIDINE KINASE
    4e-16   9%  1e2hB  [c.37.1] THYMIDINE KINASE
    5e-16  12%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    5e-16  17%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    5e-16  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    6e-16  12%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    7e-16  18%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-16  13%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    8e-16   9%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-15  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-15  10%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-15   8%  2cckB  [x.x.x] THYMIDYLATE KINASE
    1e-15   9%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-15  12%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-15  12%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-15  12%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    2e-15   9%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15   8%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    3e-15  10%  2b8tD  [x.x.x] THYMIDINE KINASE
    3e-15   6%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    3e-15   9%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-15   7%  3bm2B  [x.x.x] PROTEIN YDJA
    5e-15  10%  1e2nB  [c.37.1] THYMIDINE KINASE
    6e-15  14%  2dftC  [x.x.x] SHIKIMATE KINASE
    7e-15  11%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-15  16%  3a00A  [x.x.x] GUANYLATE KINASE
    1e-14   9%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-14  12%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    1e-14  18%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-14  12%  2dftA  [x.x.x] SHIKIMATE KINASE
    2e-14  15%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-14   3%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-14  12%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-14  14%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    2e-14  11%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-14  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    3e-14  14%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-14  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    3e-14   9%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    4e-14  17%  3cmwC  [x.x.x] PROTEIN RECA
    5e-14  12%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-14   7%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-14  14%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    6e-14  13%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    9e-14  12%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-13   8%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-13   8%  3bczC  [x.x.x] PROTEIN MEMO1
    2e-13  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-13  11%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-13  11%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    2e-13  12%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-13  14%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-13   5%  3dlbB  [x.x.x] ARGONAUTE
    3e-13  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    3e-13  12%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-13   3%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    4e-13  13%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-13  24%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13   5%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    5e-13  12%  2ancD  [x.x.x] GUANYLATE KINASE
    6e-13  12%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    7e-13  32%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-13  20%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    8e-13  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    8e-13  17%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    9e-13   4%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    1e-12  12%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-12   9%  3cmvB  [x.x.x] PROTEIN RECA
    3e-12  13%  2an9A  [x.x.x] GUANYLATE KINASE
    3e-12  15%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-12  11%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    5e-12  11%  2a1fE  [x.x.x] URIDYLATE KINASE
    6e-12   7%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-12  14%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    8e-12  10%  1e2mB  [c.37.1] THYMIDINE KINASE
    9e-12   6%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    9e-12  18%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-11  12%  2cdnA  [x.x.x] ADENYLATE KINASE
    1e-11  12%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-11  10%  1e2jA  [c.37.1] THYMIDINE KINASE
    2e-11  14%  2ancB  [x.x.x] GUANYLATE KINASE
    2e-11  11%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    2e-11   7%  2c9gA  [x.x.x] PENTON PROTEIN
    3e-11  18%  3dkvA  [x.x.x] ADENYLATE KINASE
    3e-11  17%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-11   7%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    4e-11  13%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-11  21%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  11%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    7e-11   4%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    7e-11  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-11  16%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    8e-11  14%  3cmuA  [x.x.x] PROTEIN RECA
    1e-10  14%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-10  11%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-10  12%  1e2lA  [c.37.1] THYMIDINE KINASE
    1e-10  12%  2c5mD  [x.x.x] CTP SYNTHASE
    2e-10  15%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-10  11%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-10  13%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    5e-10  12%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-10  14%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    9e-10  18%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-09   9%  3dfdA  [x.x.x] PROTEIN YQBN
    1e-09  14%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    2e-09  17%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-09   9%  1chdA  [x.x.x] CHEB METHYLESTERASE
    3e-09   8%  2bsqH  [x.x.x] TRAFFICKING PROTEIN A
    4e-09   8%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    4e-09  10%  1eamA  [c.66.1] PROTEIN (VP39)
    6e-09   9%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-09  17%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    1e-08   7%  2bsqE  [x.x.x] TRAFFICKING PROTEIN A
    2e-08  16%  1e2lB  [c.37.1] THYMIDINE KINASE
    2e-08  18%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    3e-08  11%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    4e-08  13%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    4e-08  13%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    6e-08   8%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    8e-08   8%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    8e-08   8%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    1e-07  15%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    2e-07   9%  2bhvC  [x.x.x] COMB10
    2e-07  15%  2c95B  [x.x.x] ADENYLATE KINASE 1
    2e-07  19%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-07   8%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    3e-07  18%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    6e-07  11%  1e2hA  [c.37.1] THYMIDINE KINASE
    6e-07  16%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    8e-07   9%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    9e-07   9%  3csuA  [c.78.1 - c.78.1] PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
    1e-06  14%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    2e-06   9%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-06  15%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-06  13%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-06  11%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    7e-06  17%  1e2jB  [c.37.1] THYMIDINE KINASE
    7e-06   7%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    3e-05   8%  1e2mA  [c.37.1] THYMIDINE KINASE
    4e-05  17%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-05  18%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    8e-05  18%  2dwuB  [x.x.x] GLUTAMATE RACEMASE
    1e-04   6%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    1e-04  12%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-04  11%  2a5vC  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-04  19%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    3e-04  11%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    3e-04  24%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    8e-04   6%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    0.001  21%  2dwuA  [x.x.x] GLUTAMATE RACEMASE
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYFDDLELDFKKG
2d3wB           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKD---L
3b5jA           -ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLA---L
2b8tA           ---------------------------WIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPK------
3dmdC           -KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIA---------
3cmvH           -DRSMDVETISTGSLSLDIALGAGGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI--------D
3b60A           DLEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTL
3eiuA           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA-----
2ccgB           ---------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTG-
3c95A           HPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLK
1e9cA           ---------------------------ALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS---
2czvA           ------------GGGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLS
2dwoA           -SRVQKIWVPVDHR-PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFN------VG
3dmdB           VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIA---------
3cmvG           EDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI--------D
2c61B           --ARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
2bifA           ----------------------------LIVMVGLPARGKTYISKKLTRYLNFIGVPTREFN--------
2cjwB           ---------------------------YRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDG------ES
2ccgA           -----------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR--------E
3eiuB           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA-----
2b8wA           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKG---I
2akaB           ---MEDLIPLVNQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLV
1e69A           -MRLKKL--YLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGP
2dwpA           ---------------RVQKIWVPVNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVF--------N
2a2zD           ---------------------------KKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQST
3cmvC           EDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI--------D
1bifA           ---------------------------TLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFN--------
1e9dA           ------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE-
1e98A           ------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE-
2bbsA           -EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1e9fA           ---------------------------ALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
2cgtH           DKSFGAPTITKDGVSVAREIEEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAAAVEE
1d1cA           RRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQ-
2ccjB           -----------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR--------E
3b2qA           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVF------
2c03B           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAAD------
1e2dA           ---------------------------ALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELL--------R
2axpA           -----------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFEL--AKSGN
2dr3A           ----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQV
2a5gA           --------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFN---VETVT
2d62A           -VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKG
3a1wA           ----------------------------KVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF-
3b2qB           -----PPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVF------
3dhwC           MIKLSNITKVFHQGQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLS-
2c03A           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA------AD
3cmvA           SMDVETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
421pA           ------------------------------VVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVI
2awnC           -------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVG-----------------
3dm5A           -IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG-
2cckA           -----------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTRE--------
2d0kA           ----------------------------------------------------------------------
1cr4A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVE-
1e9sG           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV--------D
4dcgA           ---ANEVAKKLPYQGQLKLLLSKLQRHLDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDP
2a2zB           ---------------------------KKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQST
2c04A           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLL----------
3cddC           ----------------------------VLKAGGKIYQGWTKIGITRSLEA-SGAFDLETYKFQYKAFIK
2awnD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------KR
3da4A           -VLHPGISVYDAYH---FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLSPM
1e9sF           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS-
1aroP           ----------------------------------------------------------------------
2awnB           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP-
3czpB           -----QLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEE---
1e9rA           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS-
3d31A           MIEIESLSRKWKNF-SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLD--------G
1b0uA           KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVVRDKDGQLKV
2a30D           ---------------------------KKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQST
2ctsA           --------SSTNLKDILADLIPKEQARTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPD----
2bc9A           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQS--------
3bh0A           -SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHS--------
2b8tB           ---------------------------WIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSVE
3cr7C           ------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD---NI
3cmxA           ---LDIALGAGG-----------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
1cr1A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL--------A
2bjbA           -LQTLGLRVDVGSELTVSGRIEPGP--GARVDCGLAG----TVLRFVPPLAALGSVPVTFDGDQA---RG
2a30B           ---------------------------KKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQM
2d4uB           ----------------------------------------------------------------------
3b85A           ----------RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIIL----TRPAV
2d3wC           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLAL
2c9yA           ---------------------------IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML-------R
1dhjA           ----------------------------------------------------------------------
2c0bL           --------------------------GGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLKH
3cddD           -----------------KIYQG-WTKIGITRSLEASGAFDLETYK----FNDAQYKAFIEP--------I
2axzC           ----------------------------------------------------------------------
2d3wD           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF---KGKDL
1dkiA           LLDSKGIHYNQGNPLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSN---
1dekB           ------------------------------FLSGVKRSGKDTTADFIMSNYSAVKY--------------
1e3aB           --------QEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLNPQSG
1cjaA           ----------SFRVITTLANQANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVNNSDR
1dhiA           ----------------------------------------------------------------------
2c61A           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFA------VVF
2awoC           -------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND---
2d4uA           -------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWVA-
3bjdB           ----------------------------------------------------------------------
2d2eA           QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIL----LDGEN
2bbsB           ---TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
3d7wA           --YVSSGSFSNNIP-LLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQ--------
3dauA           ----------------------------------------------------------------------
1bg0A           --SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKH------
2boeX           ----------------------------------------------------------------------
1e6cA           --------------------------TEPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTS---G
1e9sJ           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS-
2d3wA           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFLALSPEDR
1e4yA           -------------------------------LLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAA---VK
2dr3E           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALE------
1draA           ----------------------------------------------------------------------
2c7cH           ---FGAPTITKDGVSVAREIEEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKADLKRG
1e0jA           -HLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL--------A
3bpbA           MFKARTPARSLVTSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVFVEDPVLCTSRCAI
2b92B           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMW
1e3mB           ----------------YEELFDLLLPHLEALQQSASALAELDVLVNLAER----AYTLNYTCPTFIDKPG
2bbtB           -ELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1dw9A           ---NRNIRLDLADAI----LLSKAKKDLSAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDED
3adkA           -------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGS
3dt2A           ALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
2bhjA           -------------------------------------------------IKNWGSGEILHDTLHHKATSC
2d4hB           MCLIENTNGRLMANKILSAITQPMV---VVAIVGLYRTGKSYLMNKMWCVPHPKKPGHILVLLDTEGLGQ
1e9sD           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV--------D
2awoA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTL-------LRMIAGLETITSGDLFIGEK
2bx2L           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1e9sB           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS-
2c4rL           ----------------GISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRL--------K
1e0jB           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL--------A
3dt4C           ALRIASRLAKEEGWLLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
2a5jA           ------------------------------IIIGDTGVGKSCLLLQFTDKRFQPIGVEFGAR---MVNID
3bb1A           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
3c8uA           -------TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGFHLDN-
2drcA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1cfrA           -------------------------------IISKSGEGNKYTINSAIAFDINTTEFSKVLSGLRDFIND
5dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3czpA           ---------------AQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEELE-
3d3kA           ------------KKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVLCGPHVKGA------QG
3clvA           ----------------------EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYVVN
2bofX           ----------------------------------------------------PNMSSAEWVRNNPN----
2bhvD           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
3dtbB           ASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA-
1ai4B           -------------------LTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEA
1e3mA           ------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEG-----
2eg5G           -YNQLVLAKVKCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLNDL
2akaA           RRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANG-----SGV
2bkiA           SYQGKSLGTMFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEAN-
3cr7A           ---------------------------LTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF-
1d6jB           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHRLDGDNIRFGLN
2d2fA           QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILL---DGENI
2a30A           ---------------------------KKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQST
4atjA           ----------------------------------------------------------------------
2bkhA           ----TMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEAN-
1drbA           ----------------------------------------------------------------------
1e59A           ---------------------------ESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFA
2dr3B           ----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVA------LE
2a5vA           MFVVRTAGHVIDSALGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLP--------------GG
3cddF           -----------------SGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQR
2dpyB           PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIG---ERGRE
2b8wB           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMW
3bb1B           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGP---RPVMV
3cm0A           ---------------------------QAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRD------
1dg3A           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPGHI
4dfrA           ----------------------------------------------------------------------
2d4hA           MCLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQK-----GIW
2aumB           ----------------------------------------------------------------------
1e2gA           ---------------------------ALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
2b8tC           ---------------------------WIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKP--KIDSR
2a2zA           ---------------------------KKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCN----
3cmvE           EDRSMDVETISTGSLSLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
2bdtA           -----------------------------YIITGPAGVGKSTTCKRLAAQLDNSAYIIINHVVGGYRPPW
2ck3C           IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEK------KKL
1cr2A           -SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL--------A
2ahvA           ---VKPPRINGRVPVSAQEAVNYIPDEATLCVLGAILEATTLITALADKYKQTQTPRNISPTGLGDRADR
1e9sM           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGD----
1e9rE           -GKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
2a5vB           MFVVRTAGHVIDSALGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERV-----
2aunA           ----------------------------------------------------------------------
3bb1E           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEG--PRPVMV
3cioD           -----------------HFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYS
1dekA           -------------------------------LSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAY--
3dffA           --------------------------------------------RLLAISPHL-------DDAVLSFGAG
1e9sH           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV--------D
3d3qA           ---------------------------FLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTA
3b55A           ----------------------------------------------------------------------
2ahwD           ---VKPPRINGRVPVSAQEAVNYIPDEATLCVLGAILEATTLITALADKYKQTQTPRNLSIISPTGLGDR
3bb1F           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
2a1fF           ----------------------------------------------------------------------
3ch4B           ------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGP------
2aunB           ----------------------------------------------------------------------
3bk7A           ----------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDL--------
1e9rF           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV--------D
2dpyA           PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIG---ERGRE
2c9oC           --AASGLVGQEACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSE------
3cr7D           ------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
1cr0A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLESVEET
1e2fA           ------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLR--------
2ancF           ---------------------------TLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDV
1e2kA           ---------------------------LRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTY--------W
2bhvA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e2iB           ------------------------------YIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY-----
3dt4A           ALRIASRLAKEEGWLAILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
3d1mA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3bo6B           ---LHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDKFH
3cmtD           -----------------------------VEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
3cnlA           ---------HKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWSLENGVKILDTPG
3ec1A           ----------------------------------------------------------------------
1e9sE           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV--------D
1e2iA           ---------------------------LRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIA-NIYTT
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2czvB           -----------MDIRDKEAYELAKEWFDEVVSIKFNEEVDKEKLREARKEYGKVAILLSNPK------PS
1adoA           ----------------------------------------------------------------------
2anbA           ---------------------------TLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
1afrA           ------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDLNTL
3bgwA           ------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLE-MGKKE
3dfqA           ----------------------------------------------------------------------
3be4A           ------------------------------ILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLRE-----A
3dfnA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2awoD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2nA           ------------------------------YIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLG
1e2hB           ------------------------------YIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLG
3d1mB           ----------------------------------------------------------------------
1ek0A           ------------------------------VLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQR--
1ak2A           ---------------------------VRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGS
2bwjA           -------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----GELLREEL
1cjtC           ---------------------------HRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNL---K
1aldA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3bb1C           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
2dflA           KERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGL----------
2cckB           -----------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
1akeA           -------------------------------LLGAPGAGKGTQAQFIMEKYGIPQISTG-------DMLR
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1e9rG           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV--------D
1bmfC           IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK------KL
2b8tD           ---------------------------WIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKSIRNIQSR
3bs4A           ------------EIEELDREIGIKKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISY-----
3d3qB           ---------------------------FLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTA
3bm2B           ----------------------------------------------------------------------
1e2nB           ------------------------------YIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMT--YWRV
2dftC           ------------------------------VLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSI
3dt7A           ALRIASRLAKEEGWLLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA-
3a00A           --------------------------SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTRAGEV
3bgwD           --------GVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLH--------S
3cphA           ------------------------------LLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVD
1cs4C           --------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKN---NLK
2dftA           ------------------------------VLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSI
3crmA           ------------------------------FLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDIG
1bglA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3cueF           -----------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKT
2d7vA           VAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPT---------
1accA           -WSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIAFG-----------------
3dm9B           -VKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGA
1ckvA           -AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGYNG
2dr3C           ----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVA------LE
3cmwC           ---VETISTGSLS-LDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH-----
3bv4A           ----------------------------------------------------------------------
1e4vA           -------------------------------LLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGS
1d6jA           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDG-DNIRF
2ccjA           ----------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
3cnnA           ----------KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTPG
1e1qB           ----ISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK------KL
3bczC           ---------------ASHAGS--WY---TASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCG---
1e9rD           -GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS-
3bb1G           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
2dr3D           ----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQV
3dfoC           ----------------------------------------------------------------------
1e9sI           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3dlbB           ----------------------WVEGLAVYRREHARGPGWRVLGGA-----VLDLWVSDSGAFLLEVDPA
3dvlD           ---HQAIAKMRTMIEGFDDISHGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPG-----VFVTFE
2d7vB           -AALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPT---------
1dp0A           ----------------------------------------------------------------------
1e9sL           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
2bbtA           -EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKH----------
3dymA           ----------------------------------------------------------------------
2ancD           ---------------------------TLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSH---TTRQP
2cvfA           ----------------DSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGF------
2awnA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE--------
1culC           ---------------------------HRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDI------KN
2dr3F           ---------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQV
1d8jA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3cr7B           ---------------------------LTIWLTGLSASGKSTLAVE-----LEHQLVRDRRVHAYRLDGD
3cmvB           EDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFID--------
2an9A           ---------------------------TLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
3a00B           --------------------------SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAG-
1c9kC           ------------------------------LVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDGR-
2a1fE           ----------------------------------------------------------------------
3bb1H           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEG------PR
1dvrA           ------------------------------VLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGT
1e2mB           ------------------------------YIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMT--YWRV
3di4A           ---------------PREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRALHGTHVTT
2cbzA           -ITVRNATFTWARSPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKG--------
2cdnA           ------------------------------LLLGPPGAGKGTQAVKLA-------EKLGIPQISTGELFR
2bkeA           VKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGG-----------
1e2jA           ------------------------------YIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWR-VLGASET
2ancB           ---------------------------TLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
3bwdD           ------------------------------VTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDY
2c9gA           VMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESD-----------
3dkvA           ------------------------------VLMGLPGAGKGTQAERIV--EKYGIPHISTGDMFRA----
1e9rB           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLFG
3brwA           -LECNPTARIFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNV
1e9sA           --KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLLRGDRMVI--------VD
2bboA           EVVMENVTAFWEEGLVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQF
2bv7A           ---------------CLGSPVFTPIKADISGVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALM--
3dyoA           ----------------------------------------------------------------------
1cjuC           ---------------------------HRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ--------D
3cbqA           ------------------------------MLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIM
3cmuA           ---VETISTGSLS-LDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH-----
3e8aC           ---------------------------HRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ--------D
2a1fC           ----------------------------------------------------------------------
1e2lA           ------------------------------YIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASET---
2c5mD           ----------------------------------------------------------------------
3c14C           ---------------------------HRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ--------D
3dm5B           -IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGA
1agpA           ------------------------------VVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVI
3c15C           -----------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ--------D
2a78A           ------------------------------IMVGSGGVGKSALTLQFMYDEFVEDYEPTKA----DSYRK
2e85B           ----------------------------------------------------------------------
3dfdA           -IDAEEVEVPISKRKEGNVVPFIFKAIDRIDELEKENTTKELD-------SQRFYARIAVETTV------
3ed8A           -IELKGTDFKEDGN-ILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQ---QN
1e2kB           ------------------------------YIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMT------
1chdA           ----------------------------------------------------------------------
2bsqH           ----------------------------------------------------------------------
1av6A           -MYFEEIDNELDYEPESANEVAKKLPYQGQLTVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDP
1eamA           ---------------------------LDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGR-HHD
3bb1D           -SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERFQSEGPRPVMVSRSRAGFT
3c7kA           -------------------------------LLGAGESGKSTIVKQMKIIFSGEDVKQYKPV------VY
2bsqE           ----------------------------------------------------------------------
1e2lB           ------------------------------YIDGPHGMGKTTTTQLLV--------------ALGSRDDI
3do6A           -LYPYGHYIAKIDHRFLKSLENHEDGKLIAVTPTPAGEGKTTTSIGLSSLNRIGKKSIVTL---------
3bjqB           ----------------------------------------------------------------------
1azsC           -----------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQ--------D
3c85A           -------------------------------------------------LINPGHAQVLILG------GR
1d2zD           FPAEIKKGFKYTAQDQIDEAANRLPPDQSKSQTSGKLNERPTVGVLLQLLELFSAADFVALDFLN---ES
2b0lC           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1e9sK           --KLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3cqcA           LKQGNAIMRKFKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQ
2bhvC           ----------------------------------------------------------------------
2c95B           ------------------------------FVVGGPGSGKGTQCEKI----VQKYGYTHLSTGDLLRS--
1cjvC           ---------------------------HRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLK----
1d6aA           VKSRSQVQLGIQILGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQ-VKTNFNRAFNPNP---KV
1dapA           -----EVEVNFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYILKLDRNPD----------------
1e2hA           ------------------------------YIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWR---VLGAS
2axnA           -SRVQKIWVPVD-HRPSLPRSCGPNSPTVIVMVGLPARGK------------------------------
2a5fA           ------------------------------LMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKN
3csuA           ----------------------------------------PLYQKHIISINDLSRDDLNLVLATAAKLKA
3b9qA           IKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTS---------------------------
3cddE           -----------------------------TKIGITRSLEASGAFD----LETYKFLGNDAQYKAFIEPIK
3cddA           -----------------------------TKIGITRSLEASGAFD----LETYKFLGNDAQYKAFIEPIK
3e70C           -EAVSEILETSRRI-DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGA
3b85B           ----------------QKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA--
1e2jB           ------------------------------YIDGPHGMGKTTTTQLLVALGSRDDIVYVPEP--------
2aexA           ----------------------------------------------------------------------
1e2mA           ------------------------------YIDGPHGMGKTTTTQLL-------RDDIVYVPEPMTYWRV
3dmdA           -KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTT---------------------------
2ax4A           ---------------------------CTVWLTGLSGAGKTTISFALEYLVSHAIPCYS---LDGDNVRH
2dwuB           -------------------------HKHSVIGVLDSGVGGLTVASEIIRQLPKESICYIGDNERCPYGPR
2dx7A           ----------------------------------------------------------------------
1ckeA           ------------------------------TIDGPSGAGKGTLCKAMAEWHLLDSGAIYLALAALHHHVD
2a5vC           ---------------------------PLIVVLGHDSCGAVNAALAAINDGTLPGG--------------
2ax4B           ---------------------------CTVWLTGLSGAGKTTISFALEYLVSHAIPCYSLDGDNVRHGLN
3cr8B           ----------------------------------------------------------------------
2bwjD           ------------------------------FIIGGPGSGKGTQCEKLVEKYGFTHLSTG----ELLREEL
3ci2A           ----------------------------------------------------------------------
2dwuA           -------------------------HKHSVIGVLDSGVGGLTVASEIIRQLPKESICYIGDNERCPYGP-


                         .         .         *         .         .         .         .:140
query           ISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRAYELLKKVGLADKADAYPQQ
2d3wB           LALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVLDRFDFQDLMEEKIALLKMPEDLLTRSVNVG
3b5jA           ADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAG
2b8tA           IDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFQFFDDRICEVANILAENGFVVIISGLDKNFKGE
3dmdC           --------------ASDTFRAGAIEQLEEHAKRIGV-KVIKHSYGADPAAVAYDAIQHAKARGIDVVLID
3cmvH           AEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDDSVAALTPKAEIEGEIGDSHMGLAA
3b60A           ASLRNQ--VALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL
3eiuA           AMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVILTDITNYAEALRQMGPGYMYTDLATLYERAGI
2ccgB           ---------EEIRKIVLEGNDMDIRTEAMLFA-----ASRREHLVLKVIPALKEGKVVLCDRYIDSSLAY
3c95A           ILRENPAESDNVDAQLYNGFFSDADRAAMKIVLETPRNLPALDITFVDKRIEKLLFNYRA----RNFPGT
1e9cA           ------TEIGKLLSSYLQKKSDVEDHSVHLLFSA-NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAK
2czvA           NPKPSLVKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNKDPGIDHVLAKLMVKKNVALGFSLRPLLY
2dwoA           EYRREAVKQYSSYNFFRPDNEEAMKV-----------------RKQCALAALRDVKSYLAKEGGQIAVFD
3dmdB           --------------ASDTFRAGAIEQLEEHAKRIGVKV-IKHSYGADPAAVAYDAIQHAKARGIDVVLID
3cmvG           AEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDA--LARSGAVDVIVVDSVAALTPKAEIEGLAARM
2c61B           NEEA-----QYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTRQMGYPGYMYTDLATLYERAGI
2bifA           --------------VGQYRRDMVKTYKSFEFFL-PDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFD
2cjwB           ATIILLDMWENHDHMQVGDAYLIVYSITD-RASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVS
2ccgA           PGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREH-------LVLKVIPALKEGKVVLCDRYIDSSLAY
3eiuB           AMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTEALRQMGAAGYPGYMYTDLATLYERAGI
2b8wA           WMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSF
2akaB           NSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRHVLNLTLVDLPGMTKVPVGDQ
1e69A           VRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLGEGRLEISIRKPGRRDQKLSL
2dwpA           VGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCAL---------------AALRDVKSYLAKEGGQIAVFD
2a2zD           NVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNEK-PVLFFERSVYSDRYIFASNLYESECMNETEWTI
3cmvC           AEHALDPIYARKLGVDIDNLLCSQPDTGEQALEIC--DALARSGAVDVIVVDSVAALTPKAEIEGLAARM
1bifA           --------------VGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQ-CALAALNDVRKFLSEEGGHVAVFD
1e9dA           --------IGKLLSSYLQKKSDVEDHSVHLLFSANR-WEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAK
1e98A           ---------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAK
2bbsA           --------------RISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLIT
1e9fA           ---------GKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDR-YAFSGVAFTGAK
2cgtH           LKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAM-DKVGKEGVITVEDGTGLQDELDVVEGMQFDRGY
1d1cA           ---ANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQ-
2ccjB           PGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGI
3b2qA           AAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDIT
2c03B           TQRPAAREQLRLLGEKVGVPVLEVM------------------DGESPESIRRRVEEKARLEARDLILVD
1e2dA           FPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSAN-RWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKE
2axpA           EKLFEHFNKLADEDNVIIDRFVYSNLVYA-KKFKDYSILTERQLRFIEDKIKAKAKVVYLHADRVRGDEY
2dr3A           R------QNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYI----------------------VHDL
2a5gA           YKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCDRIDEARQELHRIINDREMRDAIILIFANKQDL
2d62A           VFVPPKERD-----VAVFQSYALYPHTVYDNIA--FPLKLRKVPKQEIDKRVREVAELGLTELLNRKPRE
3a1wA           ---TYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVI
3b2qB           AAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPALRQMGRGYPGYMYTDLATLYERAGI
3dhwC           --ESELTKARRQIGMIFQHFNLLSSRTVFGNV-ALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSN
2c03A           TQRPAAREQLRLLGEKVGVPVLEVMDGESPESI------------------RRRVEEKARLEARDLILVD
3cmvA           YARKLG--------VDIDNLLCSQPDTGEQALEICD--------ALARSGAVDVISVAALTPKAEIGLAA
421pA           DGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGN
2awnC           --------------MVFQSYALYPHLSVAENMSFGL-KLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
3dm5A           ------AYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSK----------GVDIIIVDTAGRHKE
2cckA           -------------PGGVPTGEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDS
2d0kA           ---------------------ISLIAALAVDRVIGNEN-----------ALPWNLPADLAWFKRNTLNKP
1cr4A           -------ETAEDLIGLHNRVRLRQSDSLKREIIEN-------------GKFDQWFDELFGNDTFHLYDSF
1e9sG           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRND-------------YDWQ-------RYALSVVPRG
4dcgA           ILNGLRDVTLVTRFVDEEKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDFY
2a2zB           NVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI
2c04A           --------------VAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVD
3cddC           QGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADNQTLTQIADIVCKPFGIKVIVNFQRIQ
2awnD           MNDTPPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
3da4A           KINQIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGTLTISASTHRGIIGESLTRLGAM
1e9sF           -------KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------YALSVVPRG
1aroP           --------------------------NDFSDIELAAIPFNTLADH---YGERLAREQLALHESYEMGEAR
2awnB           -------PAERGVGMVFQSYALYPHLSVAENMS-FGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
3czpB           --ERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEYGIIVVKFWLA
1e9rA           -------KFGRDKDIILNPYDQRTKGWSFFNEIRND-YDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
3d31A           KDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPK----RVLDTARDLKIEHLLDRNPLT
1b0uA           ADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPQVLGLSKHDARERALKYLAKVGIDERAQGKYPVH
2a30D           NVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPV-LFFERSVYSDRYIFASNLYESECMNETEWTI
2ctsA           EGIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKKRAALPSHVVTMLDNFPTN
2bc9A           ------------HTKGIWMWCVPHPKKPGHILVL-LDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNS
3bh0A           ---LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDW-GKLSMAIGEISNSNINIFDKAGQSVNYIWS
2b8tB           VES---------APEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGE
3cr7C           RFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPDPKGLYKKA
3cmxA           Y--------ARKLGVDIDNLLCSQPDTGEQALEICDALTPKAEARMMSQAMRKLAGNLKQSNTLLIFINQ
1cr1A           MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIE-------------NGKFDQWFDELFGNDTFHLYDSF
2bjbA           RPIAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTV------------AIDASASSQFVSGLLLSAAS-
2a30B           MYEK-----PERWSFTFQTYACLSRIRAQLASLNDEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI
2d4uB           ---------RAGIRYMMDQNNIGSGSTVAELMESASLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDI
3b85A           EAGEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFL
2d3wC           SPEDRAGEGIFMAFQYPVEIPGVSNQALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVG
2c9yA           AMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQADLMEKRKEKLDSV
1dhjA           ------------------------------------AALAVDRVIGMENAMPWNLPASLAWFKRNTLDKP
2c0bL           WEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEIDNPKVLELARQHIAALGRPDFSSKIKLYTGE
3cddD           KQGQACVDIGGERVITGYVDDWVPSYDEDLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTQRIQ
2axzC           --------------IYLGYISIAHHYNIEVPT-FNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYE
2d3wD           LALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDIALLKMPEDLLTRSVNVG
1dkiA           ------NPYFNHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMA---ISELMADVGISVDMDYGPSSGS
1dekB           ---QLAGPIKDALAYAWGVFAANTDYPLTRKEFEGID---------YDRETNLNLTKLEVITIMEQAFCY
1e3aB           YIANWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVSRQDLNLRLFLPTLQAATSG
1cjaA           L-PIAWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDIIT
1dhiA           ---------------------ISLIAALAVDRVIG-----------MENAMPWNLPASLAWFKRNTLDKP
2c61A           AAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDIT
2awoC           ----------TPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
2d4uA           LLQTRNTLNRAGIRYMMDQNNIGSGSTVAMESASISLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDI
3bjdB           -----------------QAYAAYQQLLYVLSL----------SDDVATAQTRRWLARAIYRVEERFPAAD
2d2eA           ILELSPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRY
2bbsB           ------------RISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGIT
3d7wA           --------SYFLSDAPAGAETQDFSGTTSSSQPFNG------SYPDLERYAGHRDQIPLGIDQLIQSVTA
3dauA           ---------------------ISLIAALAVDRVIG-----------MENAMPWNLPADLAWFKRNTLNKP
1bg0A           ----PPKQWGDINTLVGLDPAGQFIISTRVRCYPFNPCLTAEQYKEMEEKVSSTLSSMEDELKGTYYPTG
2boeX           -----------------------PNMSSAEWVR---NNPNDPRTPVIRDRIASVPQGTWFAHHN---PGQ
1e6cA           MTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPQASLQAHQR
1e9sJ           -------KFGRDKDIILNPYDQRTKGWSFFNEIRN--------------------DYDWQRYALSVVPRG
2d3wA           AGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVG
1e4yA           SGSELGKQAKDIMDAGKLVTDE-------------------------LVIALVKERIAQEDCRNGFLLDG
2dr3E           EHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGK----------------------EYEKYIVHDL
1draA           ---------------------ISLIAALAVDRVIG-----------MENAMPWNLPAELAWFKRNTLDKP
2c7cH           IDKKALSVPCSDSKAIAQVGTANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDE-LDVVEGMQFDRGY
1e0jA           MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDT----FHLYDSFAEAETDRLL
3bpbA           ITRPGAESRRGETEIEETVQRFYPGKVERIEAPGT----VEAGDI----MMVGDHFYIGESARTNAEGAR
2b92B           KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVNSIGTINQQAMDQLYYVTELTHRIRSKSS
1e3mB           IRRHPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFT
2bbtB           -------------RISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGIT
1dw9A           SILLLQIPLRGDRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVK-KVADPEGGERAVIT
3adkA           ARGK-----MLSEIMEKGQLVPLETVLDMLRDA-MVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLL
3dt2A           GNL-------RAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEDEPLAPGVTITS
2bhjA           LGSIMNPKSLT---RGPRDKPTPLEELLPHAINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDE
2d4hB           NDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDSADFVSFFPDFVWTLRDFSLDLE
1e9sD           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL--------------------SVVPRG
2awoA           RMNDTPPA-ERGVGMVFQSYALYPHLSVAENMSFGLKLA-GAKKEVINQRVNQVAEVLQLAHLLDRKPKA
2bx2L           -WEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGFSSKIKLYTGE
3ecpA           -----LHRAADWAKSVFSSAALGPRRTARLVNVAASGKSITISSEGSKAAQEGAYRFIRNPN--VSAEAI
1e9sB           -------KFGRDKDIILNPYDQRTKGWSFFNEIRND-YDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
2c4rL           HWEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGFSSKIKLYTGE
1e0jB           MLEESVEETAEDLIGLHNRVRLRQSDSLKREII----ENGKFDQWFDELFGNDTFHLYDSFAEAETDRLL
3dt4C           GNLRAI-------NPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTI
2a5jA           GKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITR-RETFNHLTSWLEDARQHSSSNMVIMLIGNK
3bb1A           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGK-
3c8uA           --------------RLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRA--RDIAIA----
2drcA           ---------------------ISLIAALAVDRVIG-----------MENAMPFNLPADLAWFKRNTLDKP
1eilA           ---------------------------------------IERLGY----LGFAVKDVPAWDHFLTKSVGL
1cfrA           EAIRLGGKI---SDGSFNKCNWYEWLIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLNN-----VNL
5dfrA           -------------------------------------------LAVDRVIGPWNLPADLAWFKRNTLDKP
1dyhA           ---------------------ISLIAALAVDRVIG-----------MENAMPWNLPADLAWFKRNTLDKP
3czpA           ---RPPQWRFWRRLPPKGRTGIFFGNWYSQLYARVEGHIKEAKLDQAIDAAERFERLCDEGALLFKFWFH
3d3kA           ISCGRHLANHDVQVILFLPN--FVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVF
3clvA           LNNENLCNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILVA
2bofX           ---------DPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGAP
2bhvD           --------------RTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNN
2aumA           ------------------DQTWQPIDGRVALIAPASAI-----ATEVLEATLRQLEVHGVGRHVEARYRY
3dtbB           ------QGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGYWEGIDEPLAPGVTITS
1ai4B           NWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQSRQDLNLRLFLPTLQAATSG
1e3mA           --RHPVVEQVLNEPFIANPLNLSPQRRL-IITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIF
2eg5G           FPNDFNSVFKLLPSFYRKLEK-ENGRKIGSCLIGAMPGSFYSRLFPEESMHWLSQVPSGLVTEIGTNKGS
2akaA           LEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQGFISGASIQSYLLEKSRVVFQSETERNYHIFYQL
2bkiA           ---------PLLEAFGNAKTVRNNNSSRFGKFVEIFNEKSSVVGGFVSHYLLEKSRICVQGRNYHIFYRL
3cr7A           -GLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRK-DRDTARQLHEVTGLPDPKGLYKKA
1d6jB           KDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQL-----HEVATPGEETGLPFVE
2d2fA           LELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGWTKVKKALELLDWDESYLSRYLNEG
2a30A           NVLQMMYEKPERWSFTFQTYACLSRIRAQLALKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI
4atjA           --------------LLDNTTSFRTEKDAFGNANSAGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVT
2bkhA           ---------PLLEAFGNAKTVRNNNSSRFGKFVNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRL
1drbA           ---------------------ISLIAALAVDRVIG-----------MENAMPWNLPACLAWFKRNTLDKP
1e59A           YTSVLKRAIHTLWNDELDQAWLPVEKSWKLNE-RHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPEL
2dr3B           EHPVQVRQNMAQFGWDVKPYEEKGM-------------------------FAMVDAFTAGIGEKYIVHDL
2a5vA           YVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGV----------
3cddF           IQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTI
2dpyB           VKDFIENILGPDGRARSVVIAAPADVSPLLRMQ-GAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREL
2b8wB           CVPHPKKPGHILVLLDTEGLGDVEK---------GDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQL
3bb1B           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFG
3cm0A           -HVARGTPLGERVRPIMERGDLVPDDLILEELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVLVEV
1dg3A           LVL------LDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSGTINQQAMDQLYYVTHRIRSKSDSAD
4dfrA           ---------------------ISLIAALAVDRVIG-----------MENAMPWNLPADLAWFKRNTLDKP
2d4hA           MWCVPHPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINDQLYYVTELTHRIRSKS
2aumB           ------------------DQTWQPIDGRVALIAPASAI-----ATEVLEATLRQLEVHGVGRHVEARYRY
1e2gA           GKLLS---------SYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKL-SQGVTLVVDRYAFSGVAFTGAK
2b8tC           TGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGE
2a2zA           ---VQSTNVLQMMYEKPERWSFTFQTYACLSRI----RAQLASLNGKEKPVLFFERSVYSRYIFASNLYE
3cmvE           YARKLG--------VDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAAL--TPKAEIEGLAARM
2bdtA           ESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPD-EAEALAQTVQAKVDDVEIRFIILWTNREELLRR
2ck3C           YCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS-------------------------DAAPLQY
1cr2A           MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENG------------KFDQWFDELFGNDTFHLYDSFE
2ahvA           SPLAQEGLVKWALCGHWGQSPRISD-LAEQNKIIAYNYPQGVLTQTLRAAAAHQISDIGIGTFVDPRQQG
1e9sM           ----MLSKFGRDKDIILNPYDQRTKGWSFFNEIRND-YDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
1e9rE           F--------GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------YALSVVPRG
2a5vB           ---------APSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGV----------
2aunA           ------------------DQTWQPIDGRVALIAPASAI-----ATEVLEATLRQLEVHGVGRHVEARYRY
3bb1E           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFG
3cioD           HNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVI
1dekA           --AWGVFAANTDYPLTRKEFETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKI
3dffA           LAQAAQDGANVL--VYTVFAGAAQPPAAQRHTIWGLAPDDDAVLY-RRKEDIAALDHLRVAHRHGRFLDI
1e9sH           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEI-RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
3d3qA           KVTTEEEGIPHYIDILPPDASFSAYEFKKRAKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKK
3b55A           -------------------------------------------------YNTNQIAKWLEAHAKPLKTTN
2ahwD           ADRGISPLAKWALCGHWGQSPRISD-LAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIIGIGTFVDPRQQG
3bb1F           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKL--VAKAITDSFG
2a1fF           ----------------------------------------------------------------------
3ch4B           LKEQYAQEHGLNFQYKEAFRKDMIRWGEEKRQADPGQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVAL
2aunB           -----------------------TWQPIDGRV--ALIAPASAIATEVLEATLRQLEVHGVGRHVEARYRY
3bk7A           -----------TVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNF-----YKTELLKPLGIIDLYDRNVED
1e9rF           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEI-RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
2dpyA           VKDFIENILGPDGRARSVVIAAPADVSPLLRMQ-GAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREI
2c9oC           VYSTEIKKTEVLMENFRRAIGLRIKETKKKEIIVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEV
3cr7D           LNKDLGFSENENIRRIAEVAKLFADSNSIAITSFISPYR---KDRDTARQLHEVAEETGLPDPKGLYKKA
1cr0A           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFG----------------------NDTFHLYDSF
1e2fA           -FPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQ-VPLIKEKLSQGVTLVVDRYAFSGVAFTGAK
2ancF           FLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYALIVNDDFD
1e2kA           RVLGASETIANIYTTQHRLDQGEISAGDAAVV----------------MTSAQITMGMPYAVTDAVLAPH
2bhvA           --------------RTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNN
1bccF           ------IRKWYYNAAGFNKYGLMRDDTIYENDDVKEAI-RRLPENLYDDRMFRIKRALDLNMRQQILP--
3dfnC           ----------------------------------------------------------------HSHPAL
1e2iB           ---------WRVLGASETIANIYTTQHRLDQGEISA-------GDAAVVMTSAQITMGMPYAVTDAVLAP
3dt4A           G-------NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDVYWEGIDEPLAPGVTITS
3d1mA           ----------------------------------------------------YKQFIPNVAEKTLGASGR
2e85A           --------------------------SAVTDVLLCVGNSMMGDDG------AGPLLAEKCAAAPKGNWVV
3bo6B           ISVQ-----REQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSAS
3cmtD           Y--------ARKLGVDIDNLLCSQPDTGEQALEICPKAEMGLAARMMSQAMRKLAGNLKQSNTLLIFINQ
3cnlA           ILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEF-------FEDFARKRGLL
3ec1A           -------EIPLESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRVYQLNEGQTLFFGGLARLDY
1e9sE           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYD----WQRYALSVVPRGKTDEAEEWASYGRLLL
1e2iA           QHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDA-VLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAAR
3dfoD           ------------------------------------------------------------------HPAL
3dfpD           ------------------------------------------------------------------HPAL
2czvB           LVRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGSLRPLLY
1adoA           ------------------------------------------------------------------HPAL
2anbA           EVHG----------EHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQG
1afrA           DGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGM--DPRTENSPY
3bgwA           NIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNI-----------------NIFDKAGQS
3dfqA           ------------------------------------------------------------------HPAL
3be4A           IKNGIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVN-GFVLDGFPRTIPQAEGLAKILSEIGDSLTS
3dfnA           ------------------------------------------------------------------HPAL
3dftD           ------------------------------------------------------------------HPAL
2awoD           AERGVGMVEPSVFLLDEPLDAALMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP
3cbnA           --HPNVTAGHRTTFEVTVD----PEIGETADCIIGVSSSDSISTLPDEKRAIARESLVGYDEIRGYGHPE
3dftC           ------------------------------------------------------------------HPAL
3dfqD           ------------------------------------------------------------------HPAL
2ausC           -----------------------------EVIVKDDKAETNPKWG-FPPDKRPIELHIQYGVINDKPPGP
1e2nA           ASET----IANIYTTQHRLDQGEISAGDAAVVMT-SAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIF
1e2hB           ASEANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAHIGGEAGSPPPALTLIFDRHPIAALLC
3d1mB           ----------------------------------------------------PLAYKQFIAEKTLGASGR
1ek0A           --VTINEHTVKFEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEIIALVGNKID
1ak2A           ELGKKLKATMDAGKLVSDEMVLELIEKNLETPPC---KNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSV
2bwjA           ASES---ERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPRVKQGEEFGRRIGDPQLV
1cjtC           EAIETIVAAMSNLVPPVELANPENQFRVDYIL--------------------------------------
1aldA           ------------------------------------------------------------------YPAL
2a1fD           ----------------------------------------------------------------------
3bb1C           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKL--VAKAITDSFG
2dflA           ---------SGKAVYIDTEGTFRWERIENMAKALGLDI----DNVMNNIYYIRAINTDHQIAIVDDLQEL
2cckB           EIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALN
1akeA           AAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYV
3dfnD           ----------------------------------------------------------------HSHPAL
3dfpC           ----------------------------------------------------------------HSHPAL
6aldA           ------------------------------------------------------------------HPAL
1e9rG           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGK----TDEAEEWASYGRLLL
1bmfC           YCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSAT-------------------------ASDAAPLQY
2b8tD           TGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGE
3bs4A           -PLQLIIRILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWM
3d3qB           KV----TTEEEGIPHYIDILPPDASFSAYEF-KKRAEKYIKDITRRGKVPIIAGGTGLYLLYNYAFEDKK
3bm2B           ----------------ALELLIN-RRSASRLAEPAPQNILRAGRAPDWHFFVIEGEGRERFSAVLEQGAI
1e2nB           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAL
2dftC           ADIFAT-DGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGD
3dt7A           ------QGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWIDEPLAPGVTITS
3a00A           NGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSK--------------------SGKTC
3bgwD           LEMGKKENIKRLIVTAGSINAQKIKAARRDFAS----EDWGKLSMAIGEISNSNINIFDKAGQSVNYIWS
3cphA           INGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGN
1cs4C           EAIETIVAAMSNLVPPVELANPENQFRVDYIL--------------------------------------
2dftA           ADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGND
3crmA           TAK------PSRELLARYPHRLIDIRDPAESYSAAEF---RADALAAMAKATARGRIPLLVGGTMLYYKA
1bglA           ----------------------------------------------------------------APLDND
3dfqC           ------------------------------------------------------------------HPAL
3cueF           VKLQIW----DTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNK
2d7vA           LQQLEKHHLAHENCFIAN--SVETEVVT------------------------------------------
1accA           -FNEPNGNLQYQGKDITEFDFNF-DQQTSQNIKNQLAELNATNIY-------TVLDKIKLNAKMNILIRF
3dm9B           IEQLEEHAKRIGVKVIKHSYGADPAAVAYDAI----------------QHAKARGIDVVLIDTAGRSETN
1ckvA           KIEVDCDEISELLGRQFNVYDFLVDVS---------STIGRAYTLGNKFTITSELMGLDR----------
2dr3C           EHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGE-----------------------YEKYIVHDL
3cmwC           ---ALDPIYARKLGVDIDNLLCSQPDTGEQALRSGAVDVIVVDSVAA--------LTPKAEIEGEIGDSH
3bv4A           ------------------------------------------------------------------HPAL
1e4vA           ELGKQAKDIMDAGKLVTDELVIALVKE--------RIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDY
1d6jA           GLNKDLGFSEADRNENIRRIAEVAKLFADSNSIA---------------ITSFISPYRKDRDTARQLHEV
2ccjA           --------------EIRKIVLEGNDMDI-RTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAY
3cnnA           ILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEF-------FEDFARKRGLL
1e1qB           YCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMKHALIIYDDLSKQAVP
3bczC           SCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDE
1e9rD           -------KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------YALSVVPRG
3bb1G           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNL--DKLVAKAITDSFG
2dr3D           RQNM------AQFGWDVKPYEEKGM----FAMVDAFTAGIGKSKE----------------YEKYIVHDL
3dfoC           ------------------------------------------------------------------HPAL
1e9sI           F--------GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------YALSVVPRG
3dlbB           YRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKE-----------LPLPGGLSLLDYHAS
3dvlD           ETPQDIIKNARSFGWDLAKLVDEGKLFILDA--------------SPDPEGQEVVGGFDLSALIERINYA
2d7vB           LQQLEKHHLAHENCFIAN--SVETEVVT------------------------------------------
1dp0A           ------------------------------------------------KKQLLTPLRDQFTRAPLDNDIG
1e9sL           FGKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYG---RLLLRETAKKLALIG
2bbtA           ---------SGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEED-ISKFAEKDNIVLGGIT
3dymA           --------------IPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDND
2ancD           RPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGV-------DVFLDIDWQG
2cvfA           --SPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFASITAHYRAEENRSGLIAE
2awnA           ----------------------------------------------------------------------
1culC           NLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVM--------------------------------
2dr3F           RQN------MAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEK--------------------YIVHDL
1d8jA           --------------------------------------VLAKIVNYMKTRHQRGDTHPLTLDEILDETQH
3czjA           ------------------------------------------------GDKKQLLTPLRDQFTRLDNDIG
3cr7B           NIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTALHEVETGLPFVEVYPVE
3cmvB           AEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALA---RSGAVDVIVVDSVAALTPKAEIGLAARM
2an9A           EVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTS----------REAIEQVLATGVDVFLDIDWQG
3a00B           -------EVNGKDYNFVSVDEFKSMIKNNEFIEWAQFS-----------GNYYGSTVASVKQVSKSGKTC
1c9kC           ---------PAHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGDP----------EQWDYAAM
2a1fE           ----------------------------------------------------------------------
3bb1H           PVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTID-------------VLLYVDRLDAYR
1dvrA           QLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQ--MLKEQGTPLEKA
1e2mB           LGASETIANIYTTQHRLDQGEISAGDAAVVMTMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAL
3di4A           GERLWSNLPYLRPATIIEDTLGYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTRALADHTG
2cbzA           ---------SVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVN
2cdnA           RNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTD
2bkeA           --------------LSGKAVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQIAIVDDLQEL
1e2jA           IANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVT--DAVLAPHIGGEAGSPPPALTLIFDRHPIA
2ancB           EVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTS----------REAIEQVLATGVDVFLDIDWQG
3bwdD           NRLRPL--------SYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFF
2c9gA           ----------------------------------------------------------------------
3dkvA           -AMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVA---------------
1e9rB           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL---------------
3brwA           VQMAKL--------------------------VCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGV
1e9sA           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRND-YDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
2bboA           SWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDN-----------------IVLGEGGIT
2bv7A           ----------------WLKRGLRFIQVFLQSICDGE------------RDENHPNLIRVNATKAYEMALK
3dyoA           ---------SHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIG
1cjuC           IKNNLKEAIETIVAAMSNLVPPVELANP------------------------------------------
3cbqA           VDKEEV--TLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVI
3cmuA           ---ALDPIYARKLGVDIDNLLCSQPDTGEQAL-----EICDALARSGAVDVIVVDSVAALTPKAEIEGEI
3e8aC           IKNNLKEAIETIVAAMSNLVPPVELANPENQ---------------------------------------
2a1fC           ----------------------------------------------------------------------
1e2lA           IANIFTTQHRLDQGEISAGDAAVVMTSAQ-ITMGMPYAVTDAVLAPHIGGEAGSPPLTLIFDR----HPI
2c5mD           ----------------------------------------------------------------------
3c14C           IKNNLKEAIETIVAAMSNLVPPVEL---------------------------------------------
3dm5B           YHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVD-------------------------IIIV
1agpA           DGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGN
3c15C           IKNNLKEAIETIVAAMSNLVPPVELANPENQFR-------------------------------------
2a78A           KVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPNK
2e85B           -----------------------------------------------------------CAAAPKGNWVV
3dfdA           YPTFKAKELREAYKTEDPVEVAKRVLSVGGEYAN------------------------------------
3ed8A           TPIGDG-------PVLLPDNHYLSYQTVLSKD-----PNEKRDHMVLLEFV-------------------
1e2kB           -----------YWRVLGASETIANIYTTQHRLDQGEIS----AGDAAVVMTSAQITMGMPYAVTDAVLAP
1chdA           ----------------------------------------------------------------------
2bsqH           ---------------------------THNAIKFRARAAGRSTEAEIRLILDNIAKAQQTGSMLASIGQE
1av6A           I--------LNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNP
1eamA           PILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKW
3bb1D           LNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAI
3c7kA           SNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVS--------------------------------
2bsqE           -------------------------RNLSEATHNAIKFRARSTEAEIRLILDNIAKAQQTVRLGASIGQE
1e2lB           VYVPEPMTYWRVLGASETIANIFTTQHRLDQGEISAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPP
3do6A           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1azsC           IKNNLKEAIETIVAAMSNLVPPVELANPENQF--------------------------------------
3c85A           IGTGAYDELRARYGKISLGIEIREEAHRSEGRNVISGDATDPDFWERILDKLVLLAPHHQGNQTALEQLQ
1d2zD           TPARPVDGPGALISLELL----------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e6vC           -----------------------------------------------------------------AENRR
1e9sK           F--------GRDKDIILNPYDQRTKGWSFFN---------------------------------------
3cqcA           KPALIPQPTFTEKVAHEHKEKKYEM----------------------DFGIWKGHLDALTADVKEKMYNV
2bhvC           --------------RTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNN
2c95B           -EVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEFERRIGQPTLL
1cjvC           EAIETIVAAMSNLVPPVELANPENQFRVD-----------------------------------------
1d6aA           LNLQETW-GKISTAIHDAKNGVLPKPLELVD---------------------------------------
1dapA           ----------------------------------------------------------------------
1e2hA           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIA
2axnA           ----------------------------------------------------------------------
2a5fA           VKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDL
3csuA           NPQPELLK-HKVIASCFFEASTRTRLSFETSMHRLGASVVGKKGETLADTISVISTYVDARHPQEGAARL
3b9qA           ----------------------------------------------------------------------
3cddE           QGQACTVDIGGERVITGYVDDWVPSYDESITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKP
3cddA           QGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADNQTLTQIADIVCKPFGIKVIVNTQRIQ
3e70C           IEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKP
3b85B           ---------GEKLGFLPDPYLRPLHDALRDVEP--EVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQN
1e2jB           MTYWRVLGASETIANIYQHRLDQGEISAGDAA--------------------------------------
2aexA           ----------------------------------------------------------------------
1e2mA           LGASETIA--NIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHI------------GGE
3dmdA           ----------------------------------------------------------------------
2ax4A           GLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFI--SPFAKDRENARKIHESAGLPDVKGLYKRA
2dwuB           SVEEVQSFVFEMVEFLKQNTAAAATLAALQEALSIPVGVI----HPGARAAIKVTKKIGVIGQSNMYEKA
2dx7A           --------------IMPANHAFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEKE
1ckeA           VASEDALPLASHLDVRFVSTNGNLEVILEGEDVS-----GEIRTQEVANAASQVAAFPRVREALLRRQRA
2a5vC           YVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGV----------
2ax4B           RNLGFSPGDREENRRIAEVAKLFADAGLVCITSFISPF------AKDRENARKIHESAGLPDVKGLYKRA
3cr8B           -------------------------------------------------------------EALKHEALS
2bwjD           ASESERSKLI---RDIMERGDLVPSGIVLELLKEA-----------------------------------
3ci2A           ----------------------------------------------------------------------
2dwuA           RSVEEVQSFVFE----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSGGQAQRVAIARSLAMNPRYILLDEPTSALDPXXXXXXXXXXXXXXXXXXSLIIVTHNLAFAQKVADKI
2d3wB           FSGGEKKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSFIIVTHY-RILDYIKPDYV
3b5jA           LSGGQRQRIAIARALVNNPKILIFDEATSALDY-ESEHVIMRNMHKICKGRTVIIIAHRLSTV-KNADRI
2b8tA           PFGPIAKLFTYADKITKLTAICNECGAEATHSL------RKIDGKHADYNDDIVKIGCQEFYSA--VCRH
3dmdC           TAGRSETNRNLMDEMKKIARVTKPNLVIFVGDAAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALS
3cmvH           RMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETNKIAAPFKQAEF
3b60A           LSGGQRQRIAIARALLRDSPILILDEATSALDT-ESERAIQAALDELQKNRTSLVIAHRLSTI-EQADEI
3eiuA           VKGAKGSVTQIPILSMPGDDITHPIPDLSGYIT-----EGQIVVARELHRKGIYPPINVLPSLSRLMNSG
2ccgB           QGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEEGYQEIIHNESQRF
3c95A           LDYAEQQRWLEHRRQVFTPEF--LQGYADELQM-------------------------------------
1e9cA           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK----RGAFGHERYENGAFQERALRCFHQLMKDTTLNW
2czvA           SNPYERANLAWKLVEKYKVRRFLTSSAQEKWDV---RYPRDLISLGVVIGMEIPQAKASISM---YPEII
2dwoA           ATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYE
3dmdB           TAGRSETNRNLMDEMKKIARVTKPNLVIFVGDAAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALS
3cmvG           MSQAMRKLAGNLKQSNTLLIFINQGGNALKFYADIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEF
2c61B           VKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKGI-----YPPINVLPSLSRLMNSG
2bifA           ATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYE
2cjwB           VSEGRAAVVFDCKFIETSAAVQHNVKELFE-------------------GIVRQVRLRRDSKE-KNERRL
2ccgA           QGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEI
3eiuB           VKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKGI-----YPPINVLPSLSRLMNSG
2b8wA           FPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRR
2akaB           PPDIEFQIRDMLMQFVTKENCLILAVSPANSDL-ANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDAR
1e69A           LSGGEKALVGLALLFALPSPFYVLDEVDSPLDD-YNAERFKRLLKENSKHTQFIVITHNKIVME-AADLL
2dwpA           ATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYE
2a2zD           YQDWHDWMNNQFGQSLELDGIIYLQATPETCLHEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPI
3cmvC           MSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGVKVVKNKIAAPFKQAEF
1bifA           ATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYE
1e9dA           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK----RGAFGHERYENGAFQERALRCFHQLMKDTTLNW
1e98A           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE----RALRCFHQLMKDTTLNW
2bbsA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDV-LTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKI
1e9fA           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK-----------RYENGAFQERALRCFHQLMKDTTLNW
2cgtH           LSPYFINKPETGAVELESPFILLADKKISNIRELPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGI
1d1cA           LLAGATAEEKKALHLAGPESFNYLNQSGCVDIK--GVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGI
2ccjB           GVEEVRALNEF-------AINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQRF
3b2qA           NYAEALRQMGAAR---NEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSM-PGDDITHPIPD
2c03B           TAGRLQIDEPLMGELARLKEVLGPDEVLLVLDATGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALS
1e2dA           NFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-----RALRCFHQLMKDTTLNW
2axpA           IEGKDIDSILELYREVSNAGLHTYSWDTGQWSS-------------------------------------
2dr3A           TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINMARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVVDGI
2a5gA           PDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG-------------------------------------
2d62A           LSGGQRQRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQVEA---TGDR
3a1wA           LAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTG-------------------------------------
3b2qB           VKGAKGSVTQIPILSMPGDDITHPIPDLSGYIT-----EGQIVVARELHRKGIYPPINVLPSLSRLMNSG
3dhwC           LSGGQKQRVAIARALASNPKVLLCDEATSALDPTTRSILELLKDINRRLGLTILLITHEMDVVKRICDCV
2c03A           TAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGVLTKLDGDAGGAALSA
3cmvA           RMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVV-KNKIAA
421pA           KCDLAARTVESRQAQDLARSYGIPYIETSAKTR-------------------------------------
2awnC           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
3dm5A           DKALIEEMKQISNVIHPHEVILVIDGTIGQQAY------NQALAFKEATPIGSIIVTKLDGSAKGGGALS
2cckA           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTISAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEIIRFK
2d0kA           VIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLPKAQKL
1cr4A           AEAETLLAKLAYMRSGLGCDVIILDHISIRKMI--DNLMTKLKGFAKSTGVVLVVICHLKGALRQLSDTI
1e9sG           KTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAFAGSNEASKALTSAR
4dcgA           IPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDY-PNQEY
2a2zB           YQDWHDWMNNQFGQSLELDGIIYLQATPETRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPI
2c04A           TAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVLVLTKLDGDARGGAALSA
3cddC           IEQGETPHELLARLA-KQRGVLLTSDTFGNLVITRASKTKAGVSLILGDN--VKAARGRFS-WRQRFSKF
2awnD           LDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMS
3da4A           FSGKEYQILLPGEIHIKES---------------------------------------------------
1e9sF           KTDEAEEWASYGRLLLRETAKKLALIGTPSMRE-------------------------------------
1aroP           FRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTT
2awnB           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
3czpB           IDKQTQERF-KEREKTPYKRYKITEEDWRNRDK----WDQYVDAVGDVDRTSTEIAPWTLVEADKRFARV
1e9rA           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEG-------------------------------------
3d31A           LSGGEQQRVALARALVTNPKILLLDEPLSALDPTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADRI
1b0uA           LSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHV
2a30D           YQDWHDWMNNQFGQSLELDGIIYLQATPETCLHEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPI
2ctsA           LHPMSQLSAAITALNSESNFARAYAEGIH-----------------------------------------
2bc9A           IGTINQQAMDQLYYVTELTHRIRSKSDFVSFFP-------------------------------------
3bh0A           KTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKR
2b8tB           PFGPIAKLFTYADKITKLTAICNECGAEATHSL-------RKIDGKHADYNDDIVKIGCQEFYSAVCRHH
3cr7C           REGVIKEFTGISA-PYEAPANPEVHVKNYELPV-------------------------------------
3cmxA           IRNPETTTGGNALKF-YASVRLDIRRIGAVKEGENVVGSETRVKVVKN-----KIAAPFKQAEFQILYGE
1cr1A           AEAETDRLLAKLAYMRLGCDVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLKGALRQLSDTI
2bjbA           -FTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAA
2a30B           YQDWHDWMNNQFGQSLELDGIIYLQATPETCLEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPI
2d4uB           YHNALAELIQLLGAGKINE---FFDQPTQGYQD-------------------------------------
3b85A           TRLGFGSKVVTGDGLRLVRH-ILRGVDDVHFSE-------------------------------------
2d3wC           FSGGEKKRNDILQMAVLEPELCILDESDDIDAL-KVVADGVNSLRDGKRSFIIVTHYQRIL-DYIKPDYV
2c9yA           IEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNP--PKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQ
1dhjA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
2c0bL           IPLFSHYQIESQIESAFQREVRLPSGGSIVIDSRDIEETAFNTNLEAADEIARQLRLRDLGIVIDFIDMT
3cddD           IEQGETPHELLAR-LAKQRGVLLTSDTFGNLVI--TRASKTKAGVSLILGDNVKAARGRFSWRQ-RFSKF
2axzC           EVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTIKEAQYYINQFEHLKTIKNISINGYYDLEINYFLTDKN
2d3wD           FSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYV
1dkiA           AGSSRVQRALKENFGYNQSVHQINRGDFSKQDW------EAQIDKELSQNQPVYYQGVGK-----VGGHA
1dekB           LNGKSPIKGVFVFDD-EGKESVNFVAFNKITDINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALD
1e3aB           LTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETT
1cjaA           LYTGYDV--GTEGSISMQEGFLATVRECASFDLLSWQESLQKCHNLSISPQAIPFILRMLRIFH------
1dhiA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
2c61A           NYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHP-IPDLSG
2awoC           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
2d4uA           YHNALAELIQLLGAGKINE---FFDQPTQGYQD-------------------------------------
3bjdB           LSRALEQEIAAQSRERHPSYVFSGSASRAQLQV-FLRHQWFRTFRLYRDAADLLVNLTDVDEA-AALARY
2d2eA           LNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKV
2bbsB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM-EHLKKADKI
3d7wA           LRFPGGQTKTQARSILILI--QMISEAARFNPI------LWRARQYINSGASFLPDVYMLELWGQQSTQV
3dauA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
1bg0A           MSKATQQQLIDDHFLFKEGDRFLQTANACRYWPNDAKTFLVWVNEEDHLRIISMQKGGDLKTVYKRLVTA
2boeX           ITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHV
1e6cA           PTLTGRPIAEEMEAVLREREALYQDVAHYVVDA-------------------------------------
1e9sJ           KTDEAEEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSAR
2d3wA           FSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRIDYIKPDYV
1e4yA           FPRTIPQADAMKEAGINVDYVLEFDVPDELIVD--RIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEEL
2dr3E           TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINRSIILQLKRVLAGTGCTSIFVSQVSVGPGVEHGVDGI
1draA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
2c7cH           LSPYFINKPETGAVELESPFILLADKKISNIRELPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGI
1e0jA           AKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVICHLKNPDKGKAHEE
3bpbA           QMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESY----AANC
2b92B           FVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHR
1e3mB           RVGTFVETETANILHNATEYSLVLDEIGRGTSTGLSLAWACAENLANKIKALTLFATHYFELTQLPEKEG
2bbtB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK-MEHLKKADKI
1dw9A           LDGK------------------------------------------------------------------
3adkA           LYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRVRKVNAEGSVDDVFSQ--
3dt2A           WKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAM
2bhjA           LIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHD
2d4hB           ADGQPLTPDEYLTYSLPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYSNSKTKTLSGGI
1e9sD           KTDEAEEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSAR
2awoA           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIVTHDQVEAMTLADKI
2bx2L           IPLFSHYQIESQIESAFQREVRLPSGGSIVIDS--TEALTAIDINSARGDIEETAFNTNLEAADEIARQL
3ecpA           RKAGAMQTVKLA----QEFPELLAIEDTTSLSYRHQVAEELGKLGSIQDK-SRGWWVHSVLLLEATTFRT
1e9sB           AKKLALIGTPSMRELFHWTTIATFDDLRGFLE--------------------------------------
2c4rL           IPLFSHYQIESQIESAFQREVRLVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQLRLRDLGGL
1e0jB           AKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVICHLKNPDKGKAHEE
3dt4C           TSWKEWRPQDEEPCAHPNSRFCTPASQCPIIDPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAM
2a5jA           SDLESRRDVKREEGEAFAREHGLIFMETSAKTA-------------------------------------
3bb1A           -GIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIPV-VLIENSGRCNKNDSDEKV
3c8uA           ---GAAEVGPECRVAIIEGNYLLFDAPGWRDLTDVSIRLEVPADLEARLVQRWLDHGLNHDAAVARAQGN
2drcA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
1eilA           MAAGSAGDAALYRADQRAWRIAVQPGELDDLAYLEVDDAAALERMADKLRQAGVAFTRGDEAL--MQQRK
1cfrA           ITSNPDFSIIDIRGRREELKSMLKDISFSNISLTISEIDNLYKNFIDYAELEHIKSFLSVKTTFRPDRRL
5dfrA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
1dyhA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
3czpA           LSKKQLKERLSPLDWKQSEVYD------------------------------------------------
3d3kA           LRDQPWYKAAVAWANQNRAPVLSIDPPV-HIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGIN
3clvA           NKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTG-------------------------------------
2bofX           SHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLM-------------------------------------
2bhvD           NKMGYRLDIVWSRIITPHGINIMLTNGYNGLVG-------------------------------------
2aumA           LAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI------SVLLS
3dtbB           WKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPEGVPIEGIIFGGRRPAGVPLVYEALSWQHG-VFVGAA
1ai4B           LTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETT
1e3mA           TRVGFVETETANILHNATEYSLVLDEIGRGTSTGLSLAWACAENLANKIKALTLFATHYFELTQLPEKEG
2eg5G           IYSSKASRLPVQKAYLDQFTKDFTTFLRIHSE--------------------------------------
2akaA           LAGATAEEKKALHLAGPESFNYLNQSGCVDIKG---VSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGI
2bkiA           CAGASEDIRERLHLSSPDNFRYLNRGCTRYFA--------------------------------------
3cr7A           REGVIKEFTGISAPYEAANPEVHVKNYELPVQD-------------------------------------
1d6jB           VYVDVPVEVAEQRAPYEAPANPEVHVKNYELPV-------------------------------------
2d2fA           FSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKV
2a30A           YQDWHDWMNNQFGQSLELDGIIYLQATPETCLHEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPI
4atjA           LAGGPSWRVPLGRRDSLQAFNANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRL
2bkhA           CAGASEDIRERLHSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKLLDDHGDFIRMCTAM
1drbA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
1e59A           TKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHG-NSLRALVKYL
2dr3B           TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPG
2a5vA           ----------------------------------------------------------------------
3cddF           KAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGA-AKRGQWERQRSIGKSNAEYTVTGWRIGKLWNINTLV
2dpyB           AIGEPPATKGYPPSVFAKLPALV-----------------------------------------------
2b8wB           YYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIR
3bb1B           KGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKVLPNG
3cm0A           PEEELVRR--ILRRAELEGRSDDNEETVRRRLEYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAA
1dg3A           FVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLK-------------------------------------
4dfrA           VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKL
2d4hA           SPDESADFVSFFPDFVWTLRDFSLDLEADGQPLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRR
2aumB           LAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSAFHRHG
1e2gA           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQE--------RALRCFHQLMKDTTLNW
2b8tC           PFGPIAKLFTYADKITKLTAICNECGAEATHSL-------RKIDGKHADYNDDIVKIGCQEFYSAVCRHH
2a2zA           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIILQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHES
3cmvE           MSQAMRKLAGNLKQSNTLLIFINQGGNALKFYAVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQ
2bdtA           DALRKKGERCLEL--VEEFESKGIDERYFYNTS-------------------------------------
2ck3C           LAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVA-YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMN
1cr2A           AETDRLLAKLAYMRSGLGCDVIILDHISIRKMI--DNLMTKLKGFAKSTGVVLVVICHKSGALRQLSDTI
2ahvA           GKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDI--------------------------------------
1e9sM           AKKLALIGTPSMRELFHWTTIATFDDL-------------------------------------------
1e9rE           KTDEAEEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSAR
2a5vB           ----------------------------------------------------------------------
2aunA           LAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHG
3bb1E           KGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCN-KNDSDE
3cioD           VDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTA-------------------------------------
1dekA           TDVINNIEDQWSVRRLMQALGTDLIVNNFDRMY-------------------------------------
3dffA           YRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDL-VGEVADDIRSIIDEFDPTLVVTCAAIGE---HPDHE
1e9sH           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFLSDKLPEHVTMPDGD
3d3qA           QVKLKEYLASFDKESAKDIHPNNRKRVLRAIEYKLLSSRKKVQQFTENYDTLLIGIESRETLYLRINKRV
3b55A           PTASLNDLKPLKN--VGSASIVGLGEATHGAHE-VFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYV
2ahwD           GKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDI--------------------------------------
3bb1F           KGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSE-ALLQVVRSGASLKKDIPVVLIENSGRCNKNDSDEKV
2a1fF           -SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAK
3ch4B           EQSRQQRGWVFTPGVDDAESECGLDNFGDFDW--------------------VIENHGVEQRLEEQLENL
2aunB           LAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHG
3bk7A           LSGGELQRVAIAATLLRDADIYLLDEPSAYLDVQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRL
1e9rF           AKKLALIGTPSMRELFHWTTIATFDDLRGFLE--------------------------------------
2dpyA           AIGEPPATKGYPPSVFAKLPALV-----------------------------------------------
2c9oC           HMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRT--MLYTPQEMK
3cr7D           REGVIKEFTGISAP-YEAPANPEVHVKNYELPV-------------------------------------
1cr0A           AEAETDRLLAKLAYMRSGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTI
1e2fA           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK---RGAFGHERYENGAFQERALRCFHQLMKDTTLNWK
2ancF           TALTDLKTIIRAERLRMSRQKQRHDALISKLL--------------------------------------
1e2kA           IGGEAGPPPALTLIFDRHPIAALLCYPAA-----------------------------------------
2bhvA           NKMGEYRDIVWSRIITPHGINIMLTNAYNGLVGTLTNGLLIGITSAFGDYLLMQLMRQSGMGINQVVNQI
1bccF           -KEQWTKYEEDVPYLEPYLKEVI-----------------------------------------------
3dfnC           TPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
1e2iB           HIGGEAHAPPPALTLIFDRHPILLCYPAARYLM-------------------------------------
3dt4A           WKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAM
3d1mA           YEGKITRNSERFKELNYNPDIIFKDEENTGADRKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESL
2e85A           IDGGSAPENDIVAIRELRPTRLIVDATDMGLNPGEIRIIDPDDIAEMF-----MMTTHNMLIDQLKEDIG
3bo6B           SLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQALREEPFYRLMAE--
3cmtD           IRMKNPETTTGGNALKFYASVRLDIRRIGAVKE----GENVVGSETRVKVVKNKIAAPFKQAEFQILYGE
3cnlA           KKGGVPDIERALMLFFTKAGRVSFERPED-----------------------------------------
3ec1A           IKGGRRSFVCYMANELTVHRTK-LEKADSLYANQLGELLSPPSKRYAAEF---PPLVPRSLSVKERKTDI
1e9sE           RETAKKLALIGTPSMRELFHWTTIATFDDLR---------------------------------------
1e2iA           YLMGSMTPQAVLAFVALIPPTLPGT---------------------------------------------
3dfoD           TPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
3dfpD           TPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
2czvB           SNPYERANLAWKLVEKYKVRRFLTSSAQEKWDV-------------------------------------
1adoA           TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
2anbA           AQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYLIVNDDFDTALTDLKTI
1afrA           LGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAADEKR------HETAYTKIVEKLFEIDPDG
3bgwA           VNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKR
3dfqA           TPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
3be4A           VISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDFHKQTAPLVKFYEDLGILK
3dfnA           TPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
3dftD           TPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
2awoD           LELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQ------VWLPVESRDVQVGANMS
3cbnA           LTLDHPTDIVCRKSDYICSRTLIRADKAAFDLD--------ENLVRDLRKGRELKVEIIVEYE-------
3dftC           TPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
3dfqD           TPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
2ausC           TSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDV-PEDKIR
1e2nA           DRHPIAALLCYPAARYLMGSMTPQAVLA------------------------------------------
1e2hB           YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVGALPEDRHIDRLAKRLDLAMLAAIRRVYGL--LANTV
3d1mB           YEGKITRNSERFKEPNYNPDIIFKDEENTGADRRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEE
1ek0A           LQEGGERKVAREEGEKLAEEKGLLFFETSAKTG-------------------------------------
1ak2A           IEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPL
2bwjA           ICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKIEGTPEDVFLQLC
1cjtC           ----------------------------------------------------------------------
1aldA           TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
2a1fD           -------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAK
3bb1C           KGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSE-ALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEKV
2dflA           VSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQKLNKHLHQLTRLAEVYDIAVIITNQVMHTLYHVPGIR
2cckB           EFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQDLKFHEKVIEGYQEIIRFKSVNADQPLENVVEDTYQT
1akeA           LEFDVPDELIVDRIVGRRVHAPSGRVYHVLTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKY
3dfnD           TPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
3dfpC           TPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
6aldA           TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
1e9rG           RETAKKLALIGTPSMRELFHWTTIA---------------------------------------------
1bmfC           LAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAY-PGDVFYLHSRLLERAAKMN
2b8tD           PFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDD------IVKIGCQEFYSA-VCRHH
3bs4A           DLNLFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSV
3d3qB           QVKLKLKELEHLNNNKLHEYLASFDESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLL
3bm2B           AAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQESAGCAVAQAAVAQGFGG-IWRSGALTES-PVVREA
1e2nB           LCYPAARYLMGSMTPQAVLAFLIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRGLLANTVRYLQ
2dftC           RAEKYRALMAKRAPLYRRVATMRVDTNRRNPGA-------------------------------------
3dt7A           WKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAM
3a00A           ILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKD-FIFAE------------
3bgwD           KTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKR
3cphA           KSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVG----------
1cs4C           ----------------------------------------------------------------------
2dftA           RAEKYRALMAKRAPLYRRVATMRVDTNRRNPGA-------------------------------------
3crmA           L-LEGLPYTVAQLAIAPEQRQVLHARIAQ-----------------------------------------
1bglA           IGVSEATRINAWVERWKAAGHYQAEAALLQCTATLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMA
3dfqC           TPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
3cueF           CDLKDKRVVEYDVAKEFADANKMPFLETSALDS-------------------------------------
2d7vA           ----------------------------------------------------------------------
1accA           HYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYI------VEIEDTEGLKEVINDRY
3dm9B           RNLDEKKIARVTK---PNLVIFVGDALAGNAI------VEQARQFNEAVKIDGIILTKLDADARGGAALS
1ckvA           ----------------------------------------------------------------------
2dr3C           TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINMARSIILQLKRVLAGTGCTSIFVSQVSGV-EHGVDGI
3cmwC           MGLAARMMSQAMRKLAGNL---------------------------------------------------
3bv4A           TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
1e4vA           VLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRTAPLIGYYSKEAEAGNTKY
1d6jA           ATPGEETGLPFVEVYVDVPVEAPYEAPANPEV--------------------------------------
2ccjA           QGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDKFHEKVIEGYQEIIHRF
3cnnA           KKGGVPDIERALMLFFTKAGRVSFERPE------------------------------------------
1e1qB           PGREAYPGDVFYLHSRLLERAAKMNDAFGG----------------------------------------
3bczC           DEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSYYDESQGEIYRSI
1e9rD           KTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEAESLFAGSNEASKALTSAR
3bb1G           KGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSE---ALLQVVRSGASLSDIPVVLIENSGR-CNKNDSDE
2dr3D           TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTSIFVSQVSVGERGFGGPG
3dfoC           TPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI
1e9sI           KTDEAEEWASYGRLLLRETAKKLALIGTPSMR--------------------------------------
3dlbB           KGRLQGREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPWEERRRTREIASWIGRRLGLGTPE
3dvlD           IQKYRARRVSIDSVTSV----FQQYDASSVVR----RELFRLVARLKQIGATTVMTTERIEEYGPIARYG
2d7vB           ----------------------------------------------------------------------
1dp0A           VSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTFISRKTYRIDGSGQMA
1e9sL           TPSMRELFHWTTIATFDDLRGFL-----------------------------------------------
2bbtA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM-EHLKKADKI
3dymA           IGVSEATRIDPNAWVWKAAGHYQAEAALLQCTATLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMA
2ancD           AQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYLIVNDDFDTALTDLKTI
2cvfA           LSRQLQNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYF
2awnA           -----------------------------------------------------IYVTHDQVEAMTLADKI
1culC           ----------------------------------------------------------------------
2dr3F           TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTSIFVSQVSGFGPGVEDGI
1d8jA           LDIGLKQKQWLMTEAVNNPKIEVIDGKYAFKPK-------------------------------------
3czjA           VSEATRIDPNAWVERWKAAGHYQAEAALLQCTATLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMA
3cr7B           VQRDPKGLYKKAREGVIKEFTGISAPYEAPANP-------------------------------------
3cmvB           MSQAMRKLAGNLKQ-SNTLLIFINQGGNALKFY-ASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAP
2an9A           AQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDDDFDTALTDLKTI
3a00B           ILDIDMQGVKSVKAIPELNARFLFIAPPSGAHDKVIVNDDLDKAYKELK---DFIFAE------------
1c9kC           ERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRD---------IAGRVNQRLAAAADEV
2a1fE           -------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAK
3bb1H           VDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFPDGLPYDEFFSKRSEALLQVVRSGASLK-KDSDIPVV
1dvrA           IELKVDDELLVARITGRLIHPASGRSYHKIFNP-------------------------------------
1e2mB           LCYPAALMGSMTPQAVLAFVALIPPTLPGTNIVGALPEDRHIDRLAKRLDLAMLAAIRRVYGL--LANTV
3di4A           LPLHEAELVHDVLNVFCTGFTYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEASCH-----PLLV
2cbzA           LSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVI
2cdnA           IDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFAR--
2bkeA           VSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQKLNKHLHQLTRLAEVYDIAVIITNQVVP---GIRIQL
1e2jA           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLANTV
2ancB           AQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSDYLIVNDDFDTALTDLKTI
3bwdD           IDHAVPITTVQGEELKKLIGAPAYIECSSKSQE-------------------------------------
2c9gA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3brwA           IYQKLGATSEEELFSTN-EESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHESVYCNFRNKEIYTEGDAQ
1e9sA           AKKLALIGTPSMRELFHWTTIATFDDLRGFL---------------------------------------
2bboA           LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM-EHLKKADKI
2bv7A           KYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMYTRMNAEL--
3dyoA           VSEATRIDPNAWVERWKAAGHYQAEAALLQCTATLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMA
1cjuC           ----------------------------------------------------------------------
3cbqA           LVGARSREVSLEEGRHLAGTLSCKHIETSAALH-------------------------------------
3cmuA           GDSHMGLAARMMSQAMRKLAGNLKQSNTLLI---------------------------------------
3e8aC           ----------------------------------------------------------------------
2a1fC           -SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAK
1e2lA           AALLCYPAARYLMGSMTPQAVLAFVA--------------------------------------------
2c5mD           ------SCGLHVTSIKIDP-YINIDAGLTKDNNKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQ
3c14C           ----------------------------------------------------------------------
3dm5B           DTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIVTKLDGSAKGGGALS
1agpA           KCDLAARTVESRQAQDLARSYGIPYIETSAKTR-------------------------------------
3c15C           ----------------------------------------------------------------------
2a78A           SDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTR-------------------------------------
2e85B           IDGGSAPENDIVAIRELRPTRLIVDATDMGLNP-----GEIRIIDPDDIAEMFMMTTHNMPLDQLKEDIG
3dfdA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e2kB           HIGGEAHAPPPALTLIFDRHPIAALLCYPAARY-------------------------------------
1chdA           --------------LLSSEKLIAIGASTGGTEA----IRHVLQPLPLSSPAVIITQHMPPGFTRSFAERL
2bsqH           IGGVE-----------------------------------------------------------------
1av6A           VASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYL
1eamA           RCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEM----------RLLSIYTGENMRLTRVTKSDAVNYAKKM
3bb1D           VLQVVRSGASLKKDAASDIPVVLIENSGRCNDE-KVLPNGIAWIPHLVQTITEVALNKSESIFVD-KNLI
3c7kA           ----------------------------------------------------------------------
2bsqE           IGGVELEDVR------------------------------------------------------------
1e2lB           ALTLIFDRHPIAALLCYPAARYLMGS--------------------------------------------
3do6A           ----------------------------------------------------------------------
3bjqB           ------ARVVDP---------ILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKELYNTKRNTKRI
1azsC           ----------------------------------------------------------------------
3c85A           RRNYKGQIAAIAEYP-DQLEGLLESGVDAAFNI-------------------------------------
1d2zD           ----------------------------------------------------------------------
2b0lC           --------------HMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVIVNALRKLESA
1e6vC           KYMNPNYELKKLREIPDEDIVRLMGHREPGEEY-------------------------------------
1e9sK           ----------------------------------------------------------------------
3cqcA           LLFVDGGWMVD-----VREDAKEDHERTHQMVLLRKLCLPMLCFLLHTI----LHSTGQYQECLQLAD-M
2bhvC           NKMGEYLDIVWSRIITPHGINIMLTNAYNGLVG-------------------------------------
2c95B           LYVDAGPETMTQRLLKRGETSGRVDDNEETIK--------------------------------------
1cjvC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e2hA           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPG-------------------------------------
2axnA           ----------------------------------------------------------------------
2a5fA           PDAMKPHEIQEKLGLTRIRDRNWYVQPSCATS--------------------------------------
3csuA           ATEFSGNVPVLNAGDGSNQDLFTIQETQGRLDN-------------------------------------
3b9qA           -------------------------------------------------------LTKLDGSARGGCVVS
3cddE           F--GIKVIVNTDQRIQIEQGETPHELLARLAK--------------------------------------
3cddA           IEQGETPHELLAR-LAKQRGVLLTSDTFGNL---------------------------------------
3e70C           NLVIFVGDALAGNAIVEQARQFNEAVKIDG-----------------------IILTKLDADARGGAALS
3b85B           TTPAQKFL----TRLGFGSKVVTGDSGLRLVRHLRGVDDVHFSELTSSDVVRHQLVGHIV----DAYE--
1e2jB           ----------------------------------------------------------------------
2aexA           -----------------EDELAHRCSSFMAPPVMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERK
1e2mA           AGSPPALTLIFDRHPIAALLCYPAARYLMGSM--------------------------------------
3dmdA           -------------------------------------------------------LTKLDADARGGAALS
2ax4A           RAGEIKGFTGIDSDYPETPERVL---KTNLSTV-------------------------------------
2dwuB           L---HELDTYLKVHSHACPTLATVVENRLEDTA-------------------------------------
2dx7A           FSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAIIAGCTEVSVVLKQDDLKV
1ckeA           FRELPGL---IADGRDMGTVVFPDAPVKIFLDSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALV
2a5vC           ----------------------------------------------------------------------
2ax4B           RAGEIKGFTGIDSDYPETPERVL---KTNLSTV-------------------------------------
3cr8B           LP-----SLDLDWQQQCELEM-LMTGAYSPLTG-------------------------------------
2bwjD           ----------------------------------------------------------------------
3ci2A           ---------------------------------------------------IIVLPVGTIVTMEYRIDRV
2dwuA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LFVEDGQILFQGPKDDFFNSDNQRIKNFLSAMTLSNLD
2d3wB           HVLYQGRIVKSGDFTLVKQLEEQG--------------
3b5jA           IVMEKGKIVEQGK-------------------------
2b8tA           HHKVPNRPYLNSNSEEFIK-------------------
3dmdC           ISYVIDAPILFVGVGQGYDLRPFEKEWFLERI------
3cmvH           QILYGEGINFYGELVDLGVKEKLIEKAGA---------
3b60A           VVVEDGIIVERGTHSELLA-QHGVYAQLHKM-------
3eiuA           IGAGKTREDHKAVSDQMYA-------------------
2ccgB           KSVNADQPLENVVED-----------------------
3c95A           --------------------------------------
1e9cA           KMVDASKSIEAVHEDI----------------------
2czvA           L-------------------------------------
2dwoA           ASYQPLDPDKCDRDLSLIK-------------------
3dmdB           ISYVIDAPILFVGVGQGYDLRPFEKEWFLERI------
3cmvG           QILYGEGINFYGELVDLGVKKLIEKAGAWYS-------
2c61B           IGAGKTREDHKAVSDQMYAYAEGRDLRGLVAI------
2bifA           NSYESLD---EEQDRDLSYIKIMDVGQSY---------
2cjwB           AYQKRKE-------------------------------
2ccgA           IHNESQRFKSVNADQP----------------------
3eiuB           IGAGKTREDKAVSDQMYAGYAEGRDLRGLVAI------
2b8wA           KLAQLEKLQDEELDPEFVQQVADFCSYIFSNS------
2akaB           DVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAA----
1e69A           HGVVNG--------------------------------
2dwpA           AS--YQPLDPDKCDRDLS--------------------
2a2zD           LTLDVNEDF-----KDKYESLVEKVKEFLS--------
3cmvC           QILYGEGINFYGELVDLGVKEKLI--------------
1bifA           NSYESLDEEQDRDLSYIKIMDVGQ--------------
1e9dA           KMVDASKSIEAVHEDI----------------------
1e98A           KMVDASKRIEAVHEEI----------------------
2bbsA           LILHEGSSYFYGTFSELQNLRPDFSSKLMSF-------
1e9fA           KMVDASKSIEAVHEDI----------------------
2cgtH           VKVAAVKAPGFGDRRKAMLQDIAT--------------
1d1cA           LHLGNIKFEKGAGEGAVLKDKTALNAAST---------
2ccjB           KSVNADQPLENVVED-----------------------
3b2qA           LSGYITEGQIVVARELHRKGIYPPINVLPSLS------
2c03B           ARHVTGKPIYFAGVSEKPGLEPFYPERLAGRI------
1e2dA           KMVDASKSIEAVHED-----------------------
2axpA           --------------------------------------
2dr3A           IRLDLDEIDGELKRSLIVKMRGTSHSMRRHPF------
2a5gA           --------------------------------------
2d62A           IAVNKGELQQVGTPDEVYKPVNTFVAGFIGSP------
3a1wA           --------------------------------------
3b2qB           IGAGKTREDHKAVSDQMYGYAEGRDLRGLVAI------
3dhwC           AVISNGELIEQDTVSEVFS-------------------
2c03A           RHVTGKPIYFAGVSEKPEGLEPFYPERLAGRI------
3cmvA           PFKQAEFQILYGEGINFYG-------------------
421pA           --------------------------------------
2awnC           VVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN--
3dm5A           AVAATGAPIKFITGEKIDDIEPFDPPRFVSRL------
2cckA           SVNADQPLVVEDTYQ-----------------------
2d0kA           YLTHIDAEVEGDTHFPDYEPDDWE--------------
1cr4A           IALERNQLVLVRILKCRFTGDTGIA-------------
1e9sG           FVLSDKLPEHVTMPDGDFSIRSWLEDPN----------
4dcgA           DYFHMYFMLRTVYCNKTFPTTKAKV-------------
2a2zB           LTLDVNEDF-----KDKYESLVEKVKEFLS--------
2c04A           RHVTGKPIYFAGVSEKPEGLEPFYPERLAGRI------
3cddC           TIKADSAGLPTVGGIK----------------------
2awnD           LGIRPEHLLPSDIADVILEGEVQV--------------
3da4A           --------------------------------------
1e9sF           --------------------------------------
1aroP           VQAVASAIGRAIEDEARFG-------------------
2awnB           VVLDAGRVAQVGKPLELYH-------------------
3czpB           KVLRT---------------------------------
1e9rA           --------------------------------------
3d31A           AVVMDGKLIQVGKPEEIFE-------------------
1b0uA           IFLHQGKIEEEGDPEQVFNPQSPRLQQFLKG-------
2a30D           LTLDVNEY------------------------------
2ctsA           --------------------------------------
2bc9A           --------------------------------------
3bh0A           PMLSDLGQLEQDADIIEFLYRDDYYDKESES-------
2b8tB           -HKVPNRPYLNSNSEEFF--------------------
3cr7C           --------------------------------------
3cmxA           GINFYGELVDLGVKEKLIE-------------------
1cr1A           IALERNQLVLVRLKCRFTGDTG----------------
2bjbA           V-VSGGTVRITGWPRVSVQPADHILAIL----------
2a30B           LTLDVNEY------------------------------
2d4uB           --------------------------------------
3b85A           --------------------------------------
2d3wC           HVLYQGRIVKSGDFTLVKQLEEQG--------------
2c9yA           TTPLIEYYRKRGIHSAIDASQTDVVFASI---------
1dhjA           YLTHIDAEVEGDTHFPDYEPDD----------------
2c0bL           PVRHQRAVENRLREA-----------------------
3cddD           TIKDSAGLPTVGGIKADVTDSEIGRYRP----------
2axzC           IDSYLNAVNIINIFKIIGK--EDIHRSLVEEL------
2d3wD           HVLYQGRIVKSGDFTLVKQLEEQG--------------
1dkiA           -FVIDGADGRNFYHVNW---------------------
1dekB           YLDKFNSGYDYYIVPDTRQ-------------------
1e3aB           QDGPTGSLNISVGAKILYE-------------------
1cjaA           --------------------------------------
1dhiA           YLTHIDAEVEGDTHFPDYEPDDWE--------------
2c61A           YITEGQIVVARELHRKGIY-------------------
2awoC           VVLDAGRVAQVGKPLELYH-------------------
2d4uA           --------------------------------------
3bjdB           LYGELGEEDEKGSHPRLL--------------------
2d2eA           HVMMDGRVVATGGPELALELEAKG--------------
2bbsB           LILHEGSSYFYGTFSELQNLRDERRNSILTET------
3d7wA           QHSTDGVF------------------------------
3dauA           YLTHIDAEVEGDTHFPDYEPDD----------------
1bg0A           VDNIESKLPFSHDDRFGFLTFC----------------
2boeX           QQEVLETMAYAGKALKAGS-------------------
1e6cA           --------------------------------------
1e9sJ           FVLSDKLPEHVTPDGDFSIRSWLEDPNGGNLF------
2d3wA           HVLYQGRIVKSGDFTLVKQLEEQG--------------
1e4yA           TTRKDDQEETVRKRLVEYQMTAPLIGYYSKE-------
2dr3E           IRLDLDEIDGELKRSLIVKMRGTSHSMRRHPFDITD--
1draA           YLTHIDAEVEGDTHFPDYEPDDWE--------------
2c7cH           VKVAAVKAPGFGDRRKAMLQDIATLTGGT---------
1e0jA           GRPVSITDLRGSGALRQL--------------------
3bpbA           IWVNERVIMPAGYPRTRE--------------------
2b92B           RKLAQLEKLQDEELDPEFQQVADFCSYIFSNS------
1e3mB           VANVHLDALEHGDTIAFH--------------------
2bbtB           LILHEGSSYFYGTFSELQNLRPDFSSKLMDSF------
1dw9A           --------------------------------------
3adkA           --------------------------------------
3dt2A           AAEHKGKVIMHDPFAMRPF-------------------
2bhjA           FRLWNSQLIRYAG-------------------------
2d4hB           QVNGPRLESLVLTYVNAISS------------------
1e9sD           FVLSDKLPEHVTMPDGDF--------------------
2awoA           VVLDAGRVAQVGKPLELYYPADRFVAGFIGSP------
2bx2L           RLRDLGGLIVIDFIDMTPVRHQRAVENRL---------
3ecpA           VGLLHQEWWMRPDDPADA--------------------
1e9sB           --------------------------------------
2c4rL           IVIDFIDMTPVRHQRAVEN-------------------
1e0jB           GRPVSITDLRGSGALRQL--------------------
3dt4C           AAEHKGKVIMHDPFAMRP--------------------
2a5jA           --------------------------------------
3bb1A           L--PNGIAWIPHLVQTITEVALNKSESIFVD-------
3c8uA           DLANARAIEAARLPADLT--------------------
2drcA           YLTHIDAEVEGDTHFPDYEPDDWE--------------
1eilA           VMGLLCLQDPFGLPLEIYY-------------------
1cfrA           QLAHEGSLMKALYTHLQTRTINPTGIRYYAAAT-----
5dfrA           YLTHIDAEVEGDTHFPDYEPDD----------------
1dyhA           YLTHIDAEVEGDTHFPDYEPDDWE--------------
3czpA           --------------------------------------
3d3kA           YHSPFG--------------------------------
3clvA           --------------------------------------
2bofX           --------------------------------------
2bhvD           --------------------------------------
2aumA           AFHRHGLPAIHGPVATGLGLQER---------------
3dtbB           MRSEAKVIMHDPFAMRPFFGYNF---------------
1ai4B           QDGPTGSLNISVGAKILYAVQGDKSPIPQAVD------
1e3mA           VANVHLDALEHGDTIAFH--------------------
2eg5G           --------------------------------------
2akaA           LHLGNIKFEKGAGEGAVL--------------------
2bkiA           --------------------------------------
3cr7A           --------------------------------------
1d6jB           --------------------------------------
2d2fA           HVMMDGRVVATGGPELALELEAKG--------------
2a30A           LTLDVNEY------------------------------
4atjA           YNFSNTGLPDPTLNTTYLQTLRGLCPLNGNLSALVDF-
2bkhA           KKIGLDDEEKLDLFRVVAG-------------------
1drbA           YLTHIDAEVEGDTHFPDYEPDD----------------
1e59A           DNMSEEEILELNIPTGVPLVEFDENFKPLKRYYLGNAD
2dr3B           VEHVDGIIRLDLDEIDGELKSLIVWKMRGTS-------
2a5vA           --------------------------------------
3cddF           PVIDEIGLDEELIASILFEDDAGRLAVISVV-------
2dpyB           --------------------------------------
2b8wB           KFFPKKKCFVFDRPVHRRK-------------------
3bb1B           IAWIPHLVQTITEVALNKSESIFVDKNLI---------
3cm0A           L-------------------------------------
1dg3A           --------------------------------------
4dfrA           YLTHIDAEVEGDTHFPDYEPDDWE--------------
2d4hA           KLAQLEKLQDEELDPEFVQQVADFCSYIFSNS------
2aumB           LPAIHGPVA-----TGLGLEQQERLASLASVSRL----
1e2gA           KMVDASKSIEAVHEDIRVLSEDA---------------
2b8tC           HKVPNRPYLNSNSEE-----------------------
2a2zA           WLLHRTTNFDYLQEVPILTLDVNE--------------
3cmvE           AEFQILYGEGINFYGELV--------------------
2bdtA           --------------------------------------
2ck3C           DAFGGGSLTALPVIETQAGDVSAYIPTNVISIT-----
1cr2A           IALERNNLVLVRILKCRFTGDTGIAGYM----------
2ahvA           --------------------------------------
1e9sM           --------------------------------------
1e9rE           FVLSDKLPEHVTMPDGDFSIRSWLEDPN----------
2a5vB           --------------------------------------
2aunA           LPAIHGPVATGLGLQE----------------------
3bb1E           KVLPNGIAWIPHLVQTITEVALNKSESIFV--------
3cioD           --------------------------------------
1dekA           --------------------------------------
3dffA           ATRDAALFATHEKNVPVRWEDLPYAVFKSGA-------
1e9sH           FSIRSWLEDPNGGNLFITWREDMGPALRPLISAWVD--
3d3qA           DILGHGLFNEVQHLVEQG--------------------
3b55A           LTGK---GNPSQHLTPVFKTKELDLLDWIRQY------
2ahwD           --------------------------------------
3bb1F           --LPNGIAWIPHLVQTITEVALNKSESIF---------
2a1fF           AGMNRVVGDHMGMLATVMNGAMRDSLFRADVN------
3ch4B           IEFIRSRL------------------------------
2aunB           LPAIHGPVA-----TGLGLEQQERLASLASVSRL----
3bk7A           I-VFEGEPGRHG--------------------------
1e9rF           --------------------------------------
2dpyA           --------------------------------------
2c9oC           QIIKIRAQTEGINISE----------------------
3cr7D           --------------------------------------
1cr0A           IALERNQLVLVRILKCRFTGDTGIAGYM----------
1e2fA           MVDASKSI------------------------------
2ancF           --------------------------------------
1e2kA           --------------------------------------
2bhvA           VVIREGSRVFISPNTDIFFPENEVIAEFL---------
1bccF           --------------------------------------
3dfnC           LFHETLYQKADDGR------------------------
1e2iB           --------------------------------------
3dt4A           AAEHKGKVIMHDPFAMRPF-------------------
3d1mA           HY--EGRAVDITTSDRDRSKYGMLARLAVEA-------
2e85A           EVIFLGIQPDIVGFYYPMTQPKDAVETVYQR-------
3bo6B           --------------------------------------
3cmtD           GINFYGELVDLGVKEKLIEKAGAW--------------
3cnlA           --------------------------------------
3ec1A           VFSGLGWVTCNDPGAQLVVHAPKGVDVFI---------
1e9sE           --------------------------------------
1e2iA           --------------------------------------
3dfoD           LFHETLYQ------------------------------
3dfpD           LFHETLYQ------------------------------
2czvB           --------------------------------------
1adoA           LFHETLYQ------------------------------
2anbA           IRAERLRMSRQKQRHDALISKL----------------
1afrA           TVLAFADMMRKKISMPAHL-------------------
3bgwA           PMLSDLRESGQDADIIEFLYRDDYYDKESES-------
3dfqA           LFHETLYQKADDGR------------------------
3be4A           RVNAKLPP------------------------------
3dfnA           LFHETLYQKADDGR------------------------
3dftD           LFHETLYQ------------------------------
2awoD           LGIRPEHLLPSDIADVILE-------------------
3cbnA           --------------------------------------
3dftC           LFHETLYQ------------------------------
3dfqD           LFHETLYQ------------------------------
2ausC           AVMKEFEGEIIQRTRKVYY-------------------
1e2nA           --------------------------------------
1e2hB           RYLQCGGSWREDWGQL----------------------
3d1mB           SLHYEGRAVDITTSDRDRSKYGMLARLAVEA-------
1ek0A           --------------------------------------
1ak2A           VEYYSKAIDASQTPDVVFASILAAFSKATS--------
2bwjA           TAIDSIFL------------------------------
1cjtC           --------------------------------------
1aldA           LFHETLYQ------------------------------
2a1fD           AGMNRVVGDHMGMLATVMNGAMRDSLFRADVN------
3bb1C           --LPNGIAWIPHLVQTITEVALNKSESIF---------
2dflA           IQLKKSRGNRRIAR------------------------
2cckB           I-------------------------------------
1akeA           AKVDGTKPVAEVRAD-----------------------
3dfnD           LFHETLYQ------------------------------
3dfpC           LFHETLYQ------------------------------
6aldA           LFHETLYQ------------------------------
1e9rG           --------------------------------------
1bmfC           DAFGGGSLTALPVIETQA--------------------
2b8tD           HKVPNRPYLNSNSEEFIKFFKNKK--------------
3bs4A           YRRADYVLKTRS--------------------------
3d3qB           IGIESRETLYLRINKRVDILGHGLF-------------
3bm2B           FGCREQDKIVGF--------------------------
1e2nB           CGGSWREDWGQLSGPQSNAGPRPHIGDTLFTL------
2dftC           --------------------------------------
3dt7A           AAEHKGKVIMHDPFAMRPF-------------------
3a00A           --------------------------------------
3bgwD           PMLSDLGQLEQDADIIEFLYRDDYYDKESES-------
3cphA           --------------------------------------
1cs4C           --------------------------------------
2dftA           --------------------------------------
3crmA           --------------------------------------
1bglA           ITVDVEVASDTPHPA-----------------------
3dfqC           LFHETLYQ------------------------------
3cueF           --------------------------------------
2d7vA           --------------------------------------
1accA           DMLNISSLRQDGKTFIDFKKYNDKLPLYIS--------
3dm9B           ISYVIDAPILFVGVDDLRPFEKEWF-------------
1ckvA           --------------------------------------
2dr3C           IRLDLDEIDGELKRSLIVW-------------------
3cmwC           --------------------------------------
3bv4A           LFHETLYQ------------------------------
1e4vA           AKVDGTKPVAEVRAD-----------------------
1d6jA           --------------------------------------
2ccjA           KSVNADQPLENVVED-----------------------
3cnnA           --------------------------------------
1e1qB           --------------------------------------
3bczC           EHLDKGSIIEQLDPVSFSN-------------------
1e9rD           FVLSDKLPEHVTMPDGDFS-------------------
3bb1G           KVLPNGIAWIPHLVQTITEVALNKSESIF---------
2dr3D           VEHVDGIIRLDLDEIDGELKRSLIVKMRGTS-------
3dfoC           LFHETLYQ------------------------------
1e9sI           --------------------------------------
3dlbB           AVRAQAYRLSIPKLMGRRAVSKPA--------------
3dvlD           VFVSDNVVILRNVLEG----------------------
2d7vB           --------------------------------------
1dp0A           ITVDVEVASDT---------------------------
1e9sL           --------------------------------------
2bbtA           LILHEGSSYFYGTFSELFSSDSERRNSILT--------
3dymA           ITVDVEVASDTPH-------------------------
2ancD           IRAERLRMSRQKQRHDALISKL----------------
2cvfA           RITERG--------------------------------
2awnA           VVLDAGRVAQVGKPLELYYPADRFVAGFIGSPKMNFLP
1culC           --------------------------------------
2dr3F           IRLDLDEIDGELKRSLIV--------------------
1d8jA           --------------------------------------
3czjA           ITVDVEVASDT---------------------------
3cr7B           --------------------------------------
3cmvB           FKQAEFQILYGEGINFYGELV-----------------
2an9A           IRAERLRMSRQKQRHDALISKL----------------
3a00B           --------------------------------------
1c9kC           WLVVSGIGV-----------------------------
2a1fE           AGMNRVVGDHMGMLATVMNGLAMR--------------
3bb1H           LIENSGRCNKNDSDEKVLPNGIAWIPHLVQTI------
1dvrA           --------------------------------------
1e2mB           RYLQCGGSWRE---------------------------
3di4A           EIFAPAEGLGDWPSPSVNG-------------------
2cbzA           IVMSGGKISEMGSYQELLA-RDGAFAEFLRT-------
2cdnA           --------------------------------------
2bkeA           KKSRGNRRIARVVDAPHL--------------------
1e2jA           RYLQCGGSWREDWGQLSGPRPHIGDTLFTLFRAPELLA
2ancB           IRAERLRMSRQQRHDALIS-------------------
3bwdD           --------------------------------------
2c9gA           --------------------------------------
3dkvA           --------------------------------------
1e9rB           --------------------------------------
3brwA           QLQRKRHIGNDIVAVVFQDENTPFVPDMIASN------
1e9sA           --------------------------------------
2bboA           LILHEGSSYFYGTFSELQNLQPDFSSKLMSF-------
2bv7A           --------------------------------------
3dyoA           ITVDVEVA------------------------------
1cjuC           --------------------------------------
3cbqA           --------------------------------------
3cmuA           --------------------------------------
3e8aC           --------------------------------------
2a1fC           AGMNRVVGDHMGMLATVMNGLAMR--------------
1e2lA           --------------------------------------
2c5mD           ALEPQVCVIELGVGDIESMPFIEAFRQFQFKV------
3c14C           --------------------------------------
3dm5B           AVAATGAPIKFIGTGEKIDIEPFDPPRFVSRL------
1agpA           --------------------------------------
3c15C           --------------------------------------
2a78A           --------------------------------------
2e85B           EVIFLGIQ------------------------------
3dfdA           --------------------------------------
3ed8A           --------------------------------------
1e2kB           --------------------------------------
1chdA           NKLCQISVKEAEDGERVL--------------------
2bsqH           --------------------------------------
1av6A           NKIVRNKV------------------------------
1eamA           YYLNKIVRNKVVVNFDYPNQEYDYFHMY----------
3bb1D           --------------------------------------
3c7kA           --------------------------------------
2bsqE           --------------------------------------
1e2lB           --------------------------------------
3do6A           --------------------------------------
3bjqB           DFGYEGDPYSIVPSALEAVPRELRDASQVPGI------
1azsC           --------------------------------------
3c85A           --------------------------------------
1d2zD           --------------------------------------
2b0lC           GVIESRSLGMKGTYIKVLNNKF----------------
1e6vC           --------------------------------------
1e9sK           --------------------------------------
3cqcA           VSSERHKL------------------------------
2bhvC           --------------------------------------
2c95B           --------------------------------------
1cjvC           --------------------------------------
1d6aA           --------------------------------------
1dapA           --------------------------------------
1e2hA           --------------------------------------
2axnA           --------------------------------------
2a5fA           --------------------------------------
3csuA           --------------------------------------
3b9qA           VVEELGIPVKFIGVGEAVDLQPFDPEAFVNAI------
3cddE           --------------------------------------
3cddA           --------------------------------------
3e70C           ISYVIDAPILFVGVGQGYDLRPFEKEWFLERI------
3b85B           --------------------------------------
1e2jB           --------------------------------------
2aexA           EGGGG---------------------------------
1e2mA           --------------------------------------
3dmdA           ISYVIDAPILFVGVGQGYDLRPFEKEWFLERI------
2ax4A           --------------------------------------
2dwuB           --------------------------------------
2dx7A           PLIDPMDVIAEVAVKVALE-------------------
1ckeA           LDSTTLSI------------------------------
2a5vC           --------------------------------------
2ax4B           --------------------------------------
3cr8B           --------------------------------------
2bwjD           --------------------------------------
3ci2A           RLFVDKLDNIAQ--------------------------
2dwuA           --------------------------------------