[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00428.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwA.bssp"
#ERROR : Can't open dsspfile "3c7yA.bssp"

## Summary of PDB Search
:231
    3e-08  37%  3dhwA  [x.x.x] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN[MASQUE
    7e-04  11%  3c7yA  [x.x.x] LYSOZYME
:231

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           ----------------------------------------------------------------------
3c7yA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIIVFSLNTGAYASETIRAAITSIPKGQWEAAASIGMTHK
3dhwA           ----------------------------------------------------EIPTGLIEASRAMGATPM
3c7yA           ------------------------------ALINMVFQMGETGVAGFTNSLRMLQQKRWDEAA-------


                         +         .         .         .         .         *         .:210
query           QALMRIIIPQAARVSLPPLANSFIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           QIVRKVLLPEA----LPGLVNAAT----------------------------------------------
3c7yA           VNLAKSRWYNQTPNRAKRVIT-------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxx
3dhwA           ---------------------
3c7yA           ---------------------