[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00433.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b48B.bssp"
#ERROR : Can't open dsspfile "3ct6B.bssp"
#ERROR : Can't open dsspfile "3ct6A.bssp"
#ERROR : Can't open dsspfile "3b48F.bssp"
#ERROR : Can't open dsspfile "3b48C.bssp"
#ERROR : Can't open dsspfile "3b48D.bssp"
#ERROR : Can't open dsspfile "3cr3C.bssp"
#ERROR : Can't open dsspfile "3b48E.bssp"
#ERROR : Can't open dsspfile "3b48A.bssp"

## Summary of PDB Search
:122
    2e-28  30%  3b48B  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-18  53%  3ct6B  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    1e-17  53%  3ct6A  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    2e-15  31%  3b48F  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-15  33%  3b48C  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-14  31%  3b48D  [x.x.x] UNCHARACTERIZED PROTEIN
    9e-14  51%  3cr3C  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    5e-13  31%  3b48E  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-09  31%  3b48A  [x.x.x] UNCHARACTERIZED PROTEIN
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADEILAFYDLGSA
3b48B           ---DILLVSHS-KITDGIKEIEQNASEEITIHSLGGTSDGSLGSDPKIIDTINEADSDREFLIFADLGSA
3ct6B           MTYGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSA
3ct6A           MTYGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSA
3b48F           ---DILLVSHS-KITDGIKEIEQNASEEITIHSLGGTSDGSLGSD-PKIIDTINEDSDREFLIFADLGSA
3b48C           ---DILLVSHS-KITDGIKEIEQNASEEITIHSLGGTSDGSLGSD-PKIIDTINEADDREFLIFADLGSA
3b48D           ---DILLVSHS-KITDGIKEIEQNEEITIH--SLGGTSDGSLGSD-PKIIDTINEADDREFLIFADLGSA
3cr3C           ---GIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRV-NAIEENEADNLLTFFDLGSA
3b48E           ---DILLVSHSK-ITDGIKEIEQNSEIT--IHSLGGTSDGSLGSD-PKIIDTINEDSDREFLIFADLGSA
3b48A           ---DILLVSHS-KITDGIKEIEQNE---EITIHSGGTSDGSLGSD-PKIIDTINEDSDREFLIFADLGSA


                         .         .         *         .         .         .         .:140
query           KMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLEPLKIK
3b48B           VLSSELAFDLEEKHYHLVDAPLVEGAFASAITAGVSDDLTQILAEAQ-----
3ct6B           RMNLDLVSEMTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLE-----
3ct6A           RMNLDLVSEMTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLE-----
3b48F           VLSSELAFDLEEDQQKHYDAPLVEGAFASAITAGVSDDLTQI----------
3b48C           VLSSELAFDLEEDQYHLVDAPLVEGAFASAITAGVSDDLTQI----------
3b48D           VLSSELAFDLEEDQYHLVDAPLVEGAFASAITAGVSDDLTQILAEAQ-----
3cr3C           -RNLDLVSET-DKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKLIEK
3b48E           VLSSELAFDLEEDQQKHYDAPLVEGAFASAITAGVSDDLTQI----------
3b48A           VLSSELAFDLEEDQQKHYDAPLVEGAFASAI-TAGSDDLTQI----------