[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b8cA.bssp"
#ERROR : Can't open dsspfile "3ba6A.bssp"
#ERROR : Can't open dsspfile "3a1dA.bssp"
#ERROR : Can't open dsspfile "3a1eA.bssp"
#ERROR : Can't open dsspfile "3a1cA.bssp"
#ERROR : Can't open dsspfile "2b8eC.bssp"
#ERROR : Can't open dsspfile "3a1dB.bssp"
#ERROR : Can't open dsspfile "2b8eA.bssp"
#ERROR : Can't open dsspfile "3a1eB.bssp"
#ERROR : Can't open dsspfile "2b8eB.bssp"
#ERROR : Can't open dsspfile "2amyA.bssp"
#ERROR : Can't open dsspfile "3a1cB.bssp"
#ERROR : Can't open dsspfile "3daoA.bssp"
#ERROR : Can't open dsspfile "2dfaA.bssp"
#ERROR : Can't open dsspfile "3b8eA.bssp"
#ERROR : Can't open dsspfile "3daoB.bssp"
#ERROR : Can't open dsspfile "3bigA.bssp"
#ERROR : Can't open dsspfile "2cfrA.bssp"
#ERROR : Can't open dsspfile "2b30A.bssp"
#ERROR : Can't open dsspfile "3bihA.bssp"
#ERROR : Can't open dsspfile "2b8nA.bssp"
#ERROR : Can't open dsspfile "3c0bD.bssp"
#ERROR : Can't open dsspfile "2b82A.bssp"
#ERROR : Can't open dsspfile "3c8sA.bssp"
#ERROR : Can't open dsspfile "2cllA.bssp"
#ERROR : Can't open dsspfile "152lA.bssp"
#ERROR : Can't open dsspfile "3c82A.bssp"
#ERROR : Can't open dsspfile "250lA.bssp"
#ERROR : Can't open dsspfile "2autB.bssp"
#ERROR : Can't open dsspfile "3c8qA.bssp"
#ERROR : Can't open dsspfile "3c81A.bssp"
#ERROR : Can't open dsspfile "2a8iA.bssp"
#ERROR : Can't open dsspfile "1eexG.bssp"
#ERROR : Can't open dsspfile "3e81A.bssp"
#ERROR : Can't open dsspfile "2b0cA.bssp"
#ERROR : Can't open dsspfile "1aq6A.bssp"
#ERROR : Can't open dsspfile "170lA.bssp"
#ERROR : Can't open dsspfile "2autA.bssp"
#ERROR : Can't open dsspfile "2cn1A.bssp"
#ERROR : Can't open dsspfile "2c34A.bssp"
#ERROR : Can't open dsspfile "2autD.bssp"
#ERROR : Can't open dsspfile "3cvwA.bssp"
#ERROR : Can't open dsspfile "3e58B.bssp"
#ERROR : Can't open dsspfile "3bjzD.bssp"
#ERROR : Can't open dsspfile "3dnpA.bssp"
#ERROR : Can't open dsspfile "2bduA.bssp"
#ERROR : Can't open dsspfile "3e58A.bssp"
#ERROR : Can't open dsspfile "3bjzA.bssp"
#ERROR : Can't open dsspfile "3bjzC.bssp"
#ERROR : Can't open dsspfile "3e8qA.bssp"
#ERROR : Can't open dsspfile "3e8zA.bssp"
#ERROR : Can't open dsspfile "3cvxA.bssp"
#ERROR : Can't open dsspfile "2cukA.bssp"
#ERROR : Can't open dsspfile "2a1uA.bssp"
#ERROR : Can't open dsspfile "2a0mA.bssp"
#ERROR : Can't open dsspfile "3d1rA.bssp"
#ERROR : Can't open dsspfile "1efvA.bssp"
#ERROR : Can't open dsspfile "3e6kA.bssp"
#ERROR : Can't open dsspfile "2bz0A.bssp"
#ERROR : Can't open dsspfile "1d3vA.bssp"
#ERROR : Can't open dsspfile "1e5rA.bssp"
#ERROR : Can't open dsspfile "2ejbA.bssp"
#ERROR : Can't open dsspfile "2cg9B.bssp"
#ERROR : Can't open dsspfile "2bz1A.bssp"
#ERROR : Can't open dsspfile "3ddhB.bssp"
#ERROR : Can't open dsspfile "2e6gJ.bssp"
#ERROR : Can't open dsspfile "2a1tR.bssp"
#ERROR : Can't open dsspfile "2cftA.bssp"
#ERROR : Can't open dsspfile "1dyrA.bssp"
#ERROR : Can't open dsspfile "2cfsA.bssp"
#ERROR : Can't open dsspfile "4cd2A.bssp"
#ERROR : Can't open dsspfile "3bjzB.bssp"
#ERROR : Can't open dsspfile "3cnhA.bssp"
#ERROR : Can't open dsspfile "3dv9A.bssp"
#ERROR : Can't open dsspfile "3e59B.bssp"
#ERROR : Can't open dsspfile "2aebA.bssp"

## Summary of PDB Search
:643
    2e-59  21%  3b8cA  [x.x.x] ATPASE 2, PLASMA MEMBRANE-TYPE[MASQUE : MEMB(X) 205 /
    2e-45  15%  3ba6A  [x.x.x] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM[MASQUE :
    7e-39  43%  3a1dA  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    3e-37  43%  3a1eA  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    4e-35  43%  3a1cA  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    1e-34  41%  2b8eC  [x.x.x] CATION-TRANSPORTING ATPASE
    6e-33  41%  3a1dB  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    1e-32  41%  2b8eA  [x.x.x] CATION-TRANSPORTING ATPASE
    6e-32  42%  3a1eB  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    6e-29  39%  2b8eB  [x.x.x] CATION-TRANSPORTING ATPASE
    8e-29  12%  2amyA  [x.x.x] PHOSPHOMANNOMUTASE 2
    1e-28  42%  3a1cB  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    3e-28  14%  3daoA  [x.x.x] PUTATIVE PHOSPHATSE
    5e-28   8%  2dfaA  [x.x.x] HYPOTHETICAL UPF0271 PROTEIN TTHB195
    1e-27  21%  3b8eA  [x.x.x] SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT[MASQUE :
    5e-26  12%  3daoB  [x.x.x] PUTATIVE PHOSPHATSE
    6e-26  12%  3bigA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    6e-26  11%  2cfrA  [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
    2e-23  13%  2b30A  [x.x.x] PVIVAX HYPOTHETICAL PROTEIN
    1e-22  11%  3bihA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    9e-21  10%  2b8nA  [x.x.x] GLYCERATE KINASE, PUTATIVE
    2e-20  10%  3c0bD  [x.x.x] CONSERVED ARCHAEAL PROTEIN Q6M145
    8e-20  11%  2b82A  [c.108.1 (1rm7A)] CLASS B ACID PHOSPHATASE
    3e-19  10%  3c8sA  [x.x.x] LYSOZYME
    9e-19  11%  2cllA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-18  11%  152lA  [x.x.x] T4 LYSOZYME
    5e-18  10%  3c82A  [x.x.x] LYSOZYME
    7e-18  13%  250lA  [x.x.x] T4 LYSOZYME
    8e-18  13%  2autB  [x.x.x] APHA
    9e-18  12%  3c8qA  [x.x.x] LYSOZYME
    9e-18  12%  3c81A  [x.x.x] LYSOZYME
    7e-17  11%  2a8iA  [x.x.x] THREONINE ASPARTASE 1
    1e-16  11%  1eexG  [a.23.2] PROPANEDIOL DEHYDRATASE
    1e-16  18%  3e81A  [x.x.x] ACYLNEURAMINATE CYTIDYLYLTRANSFERASE
    2e-16   8%  2b0cA  [x.x.x] PUTATIVE PHOSPHATASE
    7e-16  12%  1aq6A  [c.108.1] L-2-HALOACID DEHALOGENASE
    1e-15  13%  170lA  [x.x.x] T4 LYSOZYME
    3e-15  12%  2autA  [x.x.x] APHA
    5e-15  15%  2cn1A  [x.x.x] CYTOSOLIC 5'-NUCLEOTIDASE III
    1e-14   7%  2c34A  [x.x.x] INHIBITOR OF CYSTEINE PEPTIDASES
    1e-14  13%  2autD  [x.x.x] APHA
    2e-14   9%  3cvwA  [x.x.x] RE11660P
    4e-14  15%  3e58B  [x.x.x] PUTATIVE BETA-PHOSPHOGLUCOMUTASE
    4e-14  14%  3bjzD  [x.x.x] PHOSPHOHEPTOSE ISOMERASE
    5e-14  15%  3dnpA  [x.x.x] STRESS RESPONSE PROTEIN YHAX
    2e-13  17%  2bduA  [x.x.x] CYTOSOLIC 5'-NUCLEOTIDASE III
    3e-13  12%  3e58A  [x.x.x] PUTATIVE BETA-PHOSPHOGLUCOMUTASE
    6e-13  13%  3bjzA  [x.x.x] PHOSPHOHEPTOSE ISOMERASE
    7e-13  15%  3bjzC  [x.x.x] PHOSPHOHEPTOSE ISOMERASE
    1e-12  11%  3e8qA  [x.x.x] ARGINASE-1
    2e-12   8%  3e8zA  [x.x.x] ARGINASE-1
    2e-12   9%  3cvxA  [x.x.x] RE11660P
    3e-12  15%  2cukA  [x.x.x] GLYCERATE DEHYDROGENASE/GLYOXYLATE REDUCTASE
    2e-11  13%  2a1uA  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT,
    3e-11   7%  2a0mA  [x.x.x] ARGINASE SUPERFAMILY PROTEIN
    4e-11  10%  3d1rA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    8e-11  14%  1efvA  [c.26.2 - c.31.1] ELECTRON TRANSFER FLAVOPROTEIN
    4e-10  10%  3e6kA  [x.x.x] ARGINASE-1
    4e-10  14%  2bz0A  [x.x.x] GTP CYCLOHYDROLASE II
    1e-09   9%  1d3vA  [c.42.1] PROTEIN (ARGINASE)
    2e-09  11%  1e5rA  [b.82.2] PROLINE OXIDASE
    6e-09  13%  2ejbA  [x.x.x] PROBABLE AROMATIC ACID DECARBOXYLASE
    3e-08  10%  2cg9B  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    3e-08  10%  2bz1A  [x.x.x] GTP CYCLOHYDROLASE II
    4e-08  11%  3ddhB  [x.x.x] PUTATIVE HALOACID DEHALOGENASE-LIKE FAMILY
    7e-08  14%  2e6gJ  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-07  12%  2a1tR  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT,
    1e-07  13%  2cftA  [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
    2e-06  10%  1dyrA  [c.71.1 (1e26A)] DIHYDROFOLATE REDUCTASE
    2e-06  16%  2cfsA  [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
    3e-06   6%  4cd2A  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-06  10%  3bjzB  [x.x.x] PHOSPHOHEPTOSE ISOMERASE
    1e-04  10%  3cnhA  [x.x.x] HYDROLASE FAMILY PROTEIN
    4e-04  10%  3dv9A  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    4e-04   8%  3e59B  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    9e-04   9%  2aebA  [x.x.x] ARGINASE 1
:643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b8cA           ----------------------------------------------------------------------
3ba6A           ----------------------------------------------------------------------
3a1dA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
3a1dB           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2amyA           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3daoA           ----------------------------------------------------------------------
2dfaA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
3daoB           ----------------------------------------------------------------------
3bigA           ----------------------------------------------------------------------
2cfrA           ----------------------------------------------------------------------
2b30A           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
2b8nA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
2b82A           ----------------------------------------------------------------------
3c8sA           ----------------------------------------------------------------------
2cllA           ----------------------------------------------------------------------
152lA           ----------------------------------------------------------------------
3c82A           ----------------------------------------------------------------------
250lA           ----------------------------------------------------------------------
2autB           ----------------------------------------------------------------------
3c8qA           ----------------------------------------------------------------------
3c81A           ----------------------------------------------------------------------
2a8iA           ----------------------------------------------------------------------
1eexG           ----------------------------------------------------------------------
3e81A           ----------------------------------------------------------------------
2b0cA           ----------------------------------------------------------------------
1aq6A           ----------------------------------------------------------------------
170lA           ----------------------------------------------------------------------
2autA           ----------------------------------------------------------------------
2cn1A           ----------------------------------------------------------------------
2c34A           ----------------------------------------------------------------------
2autD           ----------------------------------------------------------------------
3cvwA           ----------------------------------------------------------------------
3e58B           ----------------------------------------------------------------------
3bjzD           ----------------------------------------------------------------------
3dnpA           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
3e58A           ----------------------------------------------------------------------
3bjzA           ----------------------------------------------------------------------
3bjzC           ----------------------------------------------------------------------
3e8qA           ----------------------------------------------------------------------
3e8zA           ----------------------------------------------------------------------
3cvxA           ----------------------------------------------------------------------
2cukA           ----------------------------------------------------------------------
2a1uA           ----------------------------------------------------------------------
2a0mA           ----------------------------------------------------------------------
3d1rA           ----------------------------------------------------------------------
1efvA           ----------------------------------------------------------------------
3e6kA           ----------------------------------------------------------------------
2bz0A           ----------------------------------------------------------------------
1d3vA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2bz1A           ----------------------------------------------------------------------
3ddhB           ----------------------------------------------------------------------
2e6gJ           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
2cftA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
4cd2A           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3cnhA           ----------------------------------------------------------------------
3dv9A           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2aebA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNSKKSITNLLDIRPEYANLELNGKLQQVKPELLN
3b8cA           ---------------------------------------------------------DGKWSEQEAAILV
3ba6A           ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
3a1dA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
3a1dB           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2amyA           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3daoA           ----------------------------------------------------------------------
2dfaA           ----------------------------------------------------------------------
3b8eA           ------------------------------------KSSKIMESFKNMVPQQALVIRNGEKMSINAEEVV
3daoB           ----------------------------------------------------------------------
3bigA           ----------------------------------------------------------------------
2cfrA           ----------------------------------------------------------------------
2b30A           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
2b8nA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
2b82A           ----------------------------------------------------------------------
3c8sA           ----------------------------------------------------------------------
2cllA           ----------------------------------------------------------------------
152lA           ----------------------------------------------------------------------
3c82A           ----------------------------------------------------------------------
250lA           ----------------------------------------------------------------------
2autB           ----------------------------------------------------------------------
3c8qA           ----------------------------------------------------------------------
3c81A           ----------------------------------------------------------------------
2a8iA           ----------------------------------------------------------------------
1eexG           ----------------------------------------------------------------------
3e81A           ----------------------------------------------------------------------
2b0cA           ----------------------------------------------------------------------
1aq6A           ----------------------------------------------------------------------
170lA           ----------------------------------------------------------------------
2autA           ----------------------------------------------------------------------
2cn1A           ----------------------------------------------------------------------
2c34A           ----------------------------------------------------------GSHMIAPLSVKD
2autD           ----------------------------------------------------------------------
3cvwA           ----------------------------------------------------------------------
3e58B           ----------------------------------------------------------------------
3bjzD           ----------------------------------------------------------------------
3dnpA           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
3e58A           ----------------------------------------------------------------------
3bjzA           ----------------------------------------------------------------------
3bjzC           ----------------------------------------------------------------------
3e8qA           ----------------------------------------------------------------------
3e8zA           ----------------------------------------------------------------------
3cvxA           ----------------------------------------------------------------------
2cukA           ----------------------------------------------------------------------
2a1uA           ----------------------------------------------------------------------
2a0mA           ----------------------------------------------------------------------
3d1rA           ----------------------------------------------------------------------
1efvA           ----------------------------------------------------------------------
3e6kA           ----------------------------------------------------------------------
2bz0A           ----------------------------------------------------------------------
1d3vA           ----------------------------------------------------------------------
1e5rA           -------------------------------------------------------------LGQVIEREN
2ejbA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2bz1A           ----------------------------------------------------------------------
3ddhB           ----------------------------------------------------------------------
2e6gJ           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
2cftA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
4cd2A           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3cnhA           ----------------------------------------------------------------------
3dv9A           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2aebA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTV
3b8cA           PGDIVSIKLGDIIPADARLLEGDPLVDQSALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFF
3ba6A           PGDIVEVAVGDKVPADIRIKSTTLRVDQSILTGESVS--VIKHTMLFSGTNIAAGKALGIVATTGVSTEI
3a1dA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
3a1dB           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2amyA           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3daoA           ----------------------------------------------------------------------
2dfaA           ----------------------------------------------------------------------
3b8eA           VGDLVEVKGGDRIPADLIISANGCKVDNSSLTGESEPQTRSTRNIAFFSTNCVEGTARGIVVYTGDRTVM
3daoB           ----------------------------------------------------------------------
3bigA           ----------------------------------------------------------------------
2cfrA           ----------------------------------------------------------------------
2b30A           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
2b8nA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
2b82A           ----------------------------------------------------------------------
3c8sA           ----------------------------------------------------------------------
2cllA           ----------------------------------------------------------------------
152lA           ----------------------------------------------------------------------
3c82A           ----------------------------------------------------------------------
250lA           ----------------------------------------------------------------------
2autB           ----------------------------------------------------------------------
3c8qA           ----------------------------------------------------------------------
3c81A           ----------------------------------------------------------------------
2a8iA           ----------------------------------------------------------------------
1eexG           ----------------------------------------------------------------------
3e81A           ----------------------------------------------------------------------
2b0cA           ----------------------------------------------------------------------
1aq6A           ----------------------------------------------------------------------
170lA           ----------------------------------------------------------------------
2autA           ----------------------------------------------------------------------
2cn1A           ----------------------------------------------------------------------
2c34A           NDKWVDTHVGKTTEIHLVGFVGKDVLSDEILEVVCKYTPTPSSTPMVGVGGIYV--VLVKPRKRGHHTLE
2autD           ----------------------------------------------------------------------
3cvwA           ----------------------------------------------------------------------
3e58B           ----------------------------------------------------------------------
3bjzD           ----------------------------------------------------------------------
3dnpA           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
3e58A           ----------------------------------------------------------------------
3bjzA           ----------------------------------------------------------------------
3bjzC           ----------------------------------------------------------------------
3e8qA           ----------------------------------------------------------------------
3e8zA           ----------------------------------------------------------------------
3cvxA           ----------------------------------------------------------------------
2cukA           ----------------------------------------------------------------------
2a1uA           ----------------------------------------------------------------------
2a0mA           ----------------------------------------------------------------------
3d1rA           ----------------------------------------------------------------------
1efvA           ----------------------------------------------------------------------
3e6kA           ----------------------------------------------------------------------
2bz0A           ----------------------------------------------------------------------
1d3vA           ----------------------------------------------------------------------
1e5rA           FRDILFLLSKVHYKYDVHPSETYDWLEISKQAGDEKMVVKAEQIRDFAVEARALSERFSLT---------
2ejbA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2bz1A           ----------------------------------------------------------------------
3ddhB           ----------------------------------------------------------------------
2e6gJ           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
2cftA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
4cd2A           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3cnhA           ----------------------------------------------------------------------
3dv9A           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2aebA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VKILELVQNASEKKTKTENFITKFSQIYTPVIVISAIMLASIPPLFLGQEFQVWLYRALIFLVISCPCAL
3b8cA           GKAAHLVDSTNQVGHFQK-VLTXXXXXXXXXXXXXXXXXXXXXXXIQRRKYRDGIDNXXXXXXXXXXXXX
3ba6A           GKIRDQMAATEQDKTPLQQKLDEFXXXXXXXXXXXXXXXXXXXXXXXNDPVHSWIRGAIYYFKIXXXXXX
3a1dA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
3a1dB           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2amyA           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3daoA           ----------------------------------------------------------------------
2dfaA           ----------------------------------------------------------------------
3b8eA           GRIATLASGLEGGQTPIAAEIEHF-XXXXXXXXXXXXXXXXXXXXXXXYTWLEAVIFXXXXXXXXXXXXX
3daoB           ----------------------------------------------------------------------
3bigA           ----------------------------------------------------------------------
2cfrA           ----------------------------------------------------------------------
2b30A           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
2b8nA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
2b82A           ----------------------------------------------------------------------
3c8sA           ----------------------------------------------------------------------
2cllA           ----------------------------------------------------------------------
152lA           ----------------------------------------------------------------------
3c82A           ----------------------------------------------------------------------
250lA           ----------------------------------------------------------------------
2autB           ----------------------------------------------------------------------
3c8qA           ----------------------------------------------------------------------
3c81A           ----------------------------------------------------------------------
2a8iA           ----------------------------------------------------------------------
1eexG           --------------------------------------------NKHPEWVKTATNKTLDDFTLENVLSN
3e81A           ----------------------------------------------------------------------
2b0cA           ----------------------------------------------------------------------
1aq6A           ----------------------------------------------------------------------
170lA           ----------------------------------------------------------------------
2autA           ----------------------------------------------------------------------
2cn1A           ----------------------------------------------------------------------
2c34A           LVYTRPFEGIKPENERYTLHLN------------------------------------------------
2autD           ----------------------------------------------------------------------
3cvwA           ----------------------------------------------------------------------
3e58B           ----------------------------------------------------------------------
3bjzD           ----------------------------------------------------------------------
3dnpA           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
3e58A           ----------------------------------------------------------------------
3bjzA           ----------------------------------------------------------------------
3bjzC           ----------------------------------------------------------------------
3e8qA           ----------------------------------------------------------------------
3e8zA           ----------------------------------------------------------------------
3cvxA           ----------------------------------------------------------------------
2cukA           ----------------------------------------------------------------------
2a1uA           ----------------------------------------------------------------------
2a0mA           ----------------------------------------------------------------------
3d1rA           ----------------------------------------------------------------------
1efvA           ----------------------------------------------------------------------
3e6kA           ----------------------------------------------------------------------
2bz0A           ----------------------------------------------------------------------
1d3vA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2bz1A           ----------------------------------------------------------------------
3ddhB           ----------------------------------------------------------------------
2e6gJ           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
2cftA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
4cd2A           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3cnhA           ----------------------------------------------------------------------
3dv9A           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2aebA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VISIPLSYFGGIGASSRAGILVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLA
3b8cA           XXXXXXXXXXGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNVFCKGVEKDQVLLFA
3ba6A           XXXXXXXXXXGTRRMAKKNAIVRSLPSVETLGCTS-VICSKTGTLTTNQMSVCKMFIIDKVDGDFCSLNE
3a1dA           ---------------AELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1eA           ---------------AELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1cA           ---------------AELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
2b8eC           -------------------------DALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1dB           ---------------AELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNGDE-RELLRLA
2b8eA           -------------------------DALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1eB           ---------------AELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
2b8eB           --------------------------------KVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
2amyA           ----------------------------------ALCLFDVDGTLTAPRQKITKEDDFLQKLRQKIKIGV
3a1cB           ---------------AELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNGDE-RELLRLA
3daoA           ----------------------------------KLIATDIDGTLVKDGSLLIDPEYSVIDRLID---KG
2dfaA           --------------------------------------VDLNADAGESYGAFAYGHDREIFPLVSSA-NL
3b8eA           XXXXXXXXXXTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRM--------------------
3daoB           ---------------------------NLYFQGIKLIATDIDGTLVKDGSLLIDPEYSVIDRLIDKGIIF
3bigA           ----------------------------------------------------------------EFSRVT
2cfrA           ------------------CERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPEL--LERLARAGKA
2b30A           --------------------------EALKGADIKLLLIDFDGTLFVDKDIKVPSENIDAIKEAIEKGYM
3bihA           ---------------------------------------------------------------IEFSRVT
2b8nA           -----------------------------------------------EIQKLTSALLKSGASIEEINTVR
3c0bD           ----------------------------------------------------------------------
2b82A           ----------------------------------------------------------------------
3c8sA           ----------------------------------------------------------------------
2cllA           ----------------------------------ENLFAQLND---RREGAFVPFVTLGDPGIEQSLKII
152lA           ----------------------------------------------------------------------
3c82A           ----------------------------------------------------------------------
250lA           ----------------------------------------------------------------------
2autB           ----------------------------------------------------------------------
3c8qA           ----------------------------------------------------------------------
3c81A           ----------------------------------------------------------------------
2a8iA           ----------------------------------------------------------------------
1eexG           KVTAQPETLRLQASIAKDAGRDRLAMNFERAAELTAVPDDRILEIYNALRPYRST-------KEELLAIA
3e81A           ----------------------------------------------------------------------
2b0cA           ----------------------------------MLYIFDLGNVIVDID---------------------
1aq6A           ----------------------------------------------------------------------
170lA           ----------------------------------------------------------------------
2autA           ----------------------------------------------------------------------
2cn1A           ----------------IICGLIKGGA------AKLQIITDFDMTLSRFSYKGKRCP--------------
2c34A           ----------------------------------------------------------------------
2autD           ----------------------------------------------------------------------
3cvwA           ----------------------------------------------------------------------
3e58B           ----------------------------------------------------------------------
3bjzD           ----------------------------------------------------------------------
3dnpA           ----------------------------------QLLALNIDGALLRSNGKIHQTKDAIEYVKKKGIYVT
2bduA           ----------------------------------------------------------------------
3e58A           ----------------------------------------------------------------------
3bjzA           ----------------------------------------------------------------------
3bjzC           ----------------------------------------------------------------------
3e8qA           ----------------------------------------------------------------------
3e8zA           ----------------------------------------------------------------------
3cvxA           ----------------------------------------------------------------------
2cukA           ----------------------------------------------------------------------
2a1uA           ----------------------------------------------------------------------
2a0mA           ----------------------------------------------------------------------
3d1rA           ----------------------------------------------------------ELAIEFSRVTES
1efvA           ----------------------------------------------------------------------
3e6kA           ----------------------------------------------------------------------
2bz0A           ------------------------------------------------------------------LKRV
1d3vA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2bz1A           ----------------------------------------------------------------------
3ddhB           -------------------------------ELIKVIAFDADDTLWSNEPFFQEVE-------------K
2e6gJ           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
2cftA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
4cd2A           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3cnhA           ----------------------------------------------------------------------
3dv9A           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2aebA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AIAESSSPHPIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG
3b8cA           AMASRENQDAIDAAMVGMLADPKEARAGIREVHFLTALTYIDGSRVSKGAAKASNDLSKKVLSIIDKPEK
3ba6A           FSITGSTYAPEGEVLKNDKPIRSGQFDGLVELCALCNDSSLDFNETKGVYEKVGEATETALTTLVEKMNV
3a1dA           AIAERRSEHPIAEAIVLEHGIELGEPEKVEVIAGEG----VVADGILVGNKRLMEDFGVAALEKLEREAK
3a1eA           AIAERRSEQPIAEAIVLEHGIELGEPEKVEVIAGEG----VVADGILVGNKRLMEDFGVAALEKLEREAK
3a1cA           AIAERRSEHPIAEAIVKKALEELGEPEKVEVIAGEG----VVADGILVGNKRLMEDFGVAALEKLEREAK
2b8eC           AIAERRSEHPIAEAIVKKALEELGEPEKVEVIAGEG----VVADGILVGNKRLEDFGVAVALEKLEREAK
3a1dB           AIAERRSEHPIAEAIVKKALEHGIELGEPEK-VEVIAGEGVVADGILVGNKRLMEDFGVAALEKLEREAK
2b8eA           AIAERRSEHPIAEAIVKKALIELGEPEKVEVIAGEG----VVADGILVGNKRLEDFGVAVALEKLEREAK
3a1eB           AIAERRSEQPIAEAIVKKALEHGIELGEPEK-VEVIAGEGVVADGILVGNKRLMEDFGVAALEKLEREAK
2b8eB           AIAERRSEHPIAEAIVKKALEHGIELGEPEKVEVIAGEGV-VADGILVGNKRLEDFGVAVALEKLEREAK
2amyA           VGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYSYIAKIKLPKK
3a1cB           AIAERRSEHPIAEAIVKKALEHGIELGEPEK-VEVIAGEGVVADGILVGNKRLMEDFGVAALEKLEREAK
3daoA           IIFVVCSGRQFSSEFKLFAPIKHKLLDGGTVVRTPKEILKTYPDEDIWKGCRVRDELPACPDFCFAEDGG
2dfaA           ACGFHGGSPGRILEAVRAHGVAVGAHPGFPDLVGFGRREMALSPEEVYADVLYQIG---ALSAFLKAEGL
3b8eA           ----------------------------------------------------------------------
3daoB           VVCSGRQFSSEFKLFAPIKHKLLYITDGGTVVRTPKEILKTYPDEDIWKGCRVRDELPACDYFCFAEDGG
3bigA           ESAALAGYKWLGRGDKNTADAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRVDPIEGTRM
2cfrA           ALFVSNNSRRARPELALRFARLGFGGLRAEQLFSSALAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRA
2b30A           VSICTGRSKVGILSAFGEENLKKMNMPGVYINGTIVYDQIGYTLLDETIETDVYAELISYLVEKNLVNQE
3bihA           ESAALAGYKWLGRGDKNTADGAAVNAIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGVDPIEGTRMT
2b8nA           KHLSQVKGGRFAERVFPAKV----VALVLSDVLGDRLDVIASGPAWPDSSTSEDALKVLEGIETSESVKR
3c0bD           ----------------------------------------------------------------------
2b82A           ------SPSPLNPGTNVAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYL
3c8sA           ----------------------------------------------------------------------
2cllA           DTLIDAGADALELGVPFSDPL---ADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYGI
152lA           ----------------------------------------------------------------------
3c82A           ----------------------------------------------------------------------
250lA           ----------------------------------------------------------------------
2autB           ------STLNPGTNVAKLAEQAPVHWVSVAQLTGRPPMAVFDIDDTVLFSSPGFWRGKKTYSPDSDDY--
3c8qA           ----------------------------------------------------------------------
3c81A           ----------------------------------------------------------------------
2a8iA           ----------------------------------------------------------------------
1eexG           DDLESRYQAKICAAFVR-----------------------------------------------------
3e81A           ----------------------------------------------------------------------
2b0cA           --------FNRVLGAWSDLTRI-------------PLASLKKSFHMGEAFHQHERGEISDEAFAEALCHE
1aq6A           ----------------------------------------------------------------LAYTLG
170lA           ----------------------------------------------------------------------
2autA           -----------GTNVAKLAEQAPVVAQIENSLTGRPPMAVGFDDDTVLFSSPGFWR---GKKTYSPDSDD
2cn1A           ------TCHNIIDNCKLVTD---ECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQ--
2c34A           ----------------------------------------------------------------------
2autD           -------PSTLNPNVAKLAEQAVSVAQIENSLTGRPPMAVGFDDDTVLFSSPGFWR---GKKTYSPDSDD
3cvwA           -------------------------------------------------------------ANAAPGRYF
3e58B           ----------------------------------------------------------------------
3bjzD           ----------------------------------------------------------------------
3dnpA           LV--TNRHFRSAQKIAKSLKLDAKLITHSGAYIAEKIDAPFFEKRISDDHTFNIVQVLESYQCNIRLLHE
2bduA           ----------------------------------------------------------------------
3e58A           ------TEKYYYDRRASGQKGISIDHLPPSFFIGGNTKQVWENILRDEYD---------------KWDVS
3bjzA           ----------------------------------------------------------------------
3bjzC           ----------------------------------------------------------------------
3e8qA           ----------------------------------------------------------------------
3e8zA           ----------------------------GVEKGPAALR------KAGLVEKLKETEYNVR---DHGDLAF
3cvxA           -------------------------------------------------------------ANAAPGRYF
2cukA           ----------------------------------------------------------------------
2a1uA           ----------------------------------------------------------------------
2a0mA           ----------------------------------------------------------------------
3d1rA           AALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRDIAVDPIEG
1efvA           ----------------------------------------------------------------------
3e6kA           ----------------------------------------------------------------------
2bz0A           AEAKLPTPWGDFLMVGEELATGHDHVALVYGDISGHTPVLARVHSECLTGDALFSLRCDCGLTQIAEEGR
1d3vA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2ejbA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2bz1A           ---KRVAEAKLPTPWGDFLVGFEELVALVYGDISGHTPVLARVHSECLTGDALFSLRCDCGLTQIAEEGR
3ddhB           QYTDLLKPYGTSKEISAALFQTENNLQILGYGAKAFTISVETA------------------LQISNGKIA
2e6gJ           ----------------------------------------------------------------------
2a1tR           ----------------------------------------------------------------------
2cftA           ----------------------------------------------------------------------
1dyrA           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
4cd2A           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3cnhA           ----------------------------------------------------------------------
3dv9A           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2aebA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ
3b8cA           TKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGV-NVKMITGDQLAIGKETGRRLGMGDGFAGVFPE
3ba6A           FNTEVRNLSKVE----RANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGN----------
3a1dA           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGIK-VGMITGDNWRSAEAISRELNLDLVIAEVLPH
3a1eA           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGIKVG-MITGDNWRSAEAISRELNLDLVIAEVLPH
3a1cA           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
2b8eC           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRGI---KVGITGDNWRSAEAISRELNLDLVIAEVLPH
3a1dB           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIA-EVLP
2b8eA           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRG---IKVGITGDNWRSAEAISRELNLDLVIAEVLPH
3a1eB           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
2b8eB           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRGIK---VGITGDNWRSAEAISRELNLDLVIAEVLPH
2amyA           RGTFIEFRNGLNVSPIGRSCSQEERIEFYELDKKENIR-QKFVADLRKEFAGKGLTFSIGGQISFDVFPD
3a1cB           TAVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
3daoA           SPIFHLLRDSYGFEREVDDITRLDRNDIIKFTVFHPDKCEETPVFIPAWNKKAHLAAAGKEWVDCNAKGV
2dfaA           PLHHVKPHGALYLKACRDRETARAIALAVKAFDPGLP-LVVLPGTVYEEEARKAGLRVVL-EAFPERAYL
3b8eA           DVNFPLDNLCFVGLISMIDPPRAAVPDAVGKCRSAGI-KVIMVTGDHPITAKAIAKKYHTEIVFARTSPQ
3daoB           SPIFHLLRDSYGFEREVDDITRLDRNDIIKFTVFHPDKCLCTPVFIPAWNKKAHLAAAGKEWVDCNAKGV
3bigA           TAMGQANALAVLVGDKGCFLNAPDMYMEKLIVGPGAK-GTIDLNLPLADNLRNVAAAPLSELTVTILAKP
2cfrA           ADPSAAPRVRAVLVGYDEHFSFAKLREACAHLRDPEC-LLVATDRDPWHPLSDGSRTPGTGSLAAAVETA
2b30A           SNYVTEDNKYADFLQKMYSENRSIIIRHNEMLKYRTM-NKLMIVLDPSESKTVIGNLKQKFHAEVTKLGH
3bihA           AMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAK-GTIDLNLPLADNLRNVAAALGKPLSELTVTIL
2b8nA           AILQETPKHLSNVEIHLIGNVQKVCDEAKSLAKEKGF-NAEIITTSLDCEAREAGRFIASIKEVKFKDPL
3c0bD           ---------------------------------------GIDIGGAN--TKITELHENGEFKVHHLYFPD
2b82A           KNPVF--WEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTPATNMNPVIFAGDK
3c8sA           ------------EMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDE
2cllA           DAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPNADDDLLRQVASYGRGYTYLLSRSGV
152lA           ---------NCFEMLRCDEGLRLKIYKDCEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDE
3c82A           ------------EMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDE
250lA           ------------EMLRIDEGLRLKIYKDTEGYYTIGAGHLLTKSPSLNAAKSELDKAIVATKDEAEKLFN
2autB           -LKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDS-IYFVTGRSQTKTETVSKTLADNFHIPAANMN
3c8qA           ------------EMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVEKLFN
3c81A           ---------NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNKDEAEKLFN
2a8iA           IECDASIDGKSLNFGAVGALSRLLCEGQKGKLSAGRIP-PCFLVGEGA---YRWAVDHGIPSCPPNITTR
1eexG           ----------------------------------------------------------------------
3e81A           KLILTDIDGVYDQTGNEWKKFNTSDSAGIFWAHNKGIP-VGILTGEKTEIVRRRAEKLKVDFQGVVDKLS
2b0cA           MALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHR-VVVLSNTNRLHTTFWPEEYPEIRGMRKPEAR
1aq6A           TLGLEPDESFLADMAQAYNRLTPYPDAAQCLAELAPL-KRAILSNGAPDMLQALVANAGLAKRVFKPHPD
170lA           ------------EMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNKDEAEKLFN
2autA           YLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIY-FVTGRSQTKTETVSKTLADNFHIPAANMN
2cn1A           ---ALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIP-VFIFSAGIGDVLEEVIRQAGVYHPNVKVVSN
2c34A           ----------------------------------------------------------------------
2autD           YLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIY-FVTGRSQTKTETVSKTLADNFHIPAANMN
3cvwA           VRPIFILDPGILDWMQVGANLQQTLEDLDNQLRKLNSR-LFVVRGKPAEVFPRIFKSWRVEMLTFETDIE
3e58B           TLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLE-IGLASSSVKADIFRALEENREEFKESKPNPE
3bjzD           RQLFQASIETKQQALEVLPPYIEQASLVVNALLNEGK-ILSCGNGGSAGDAQHFSSELLLLAISTSGNSA
3dnpA           KYSIGNKKKVNSNLLGKAVESLSDLLDEPVSAPVIEVYTEHDIQHDITETITKAFPAVDVIDEKLNIVPK
2bduA           --EQGIPKAKLKEIVADSDVLKEGYENFFGKLQQHGI-PVFIFSAGIGDVLEEVIRQAGVYHSNVKHDGA
3e58A           TLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLE-IGLASSSVKADIFRALEENREEFKESKPNPE
3bjzA           RQLFQASIETKQQALEVLPPYIEQASLVVNALLNEGKI-LSCGNGGSAGDAQHFSSELLNRFISTSGNSA
3bjzC           RQLFQASIETKQQALEVLPPYIEQASLVVNALLNEGK-ILSCGNGGSAGDAQHFSSELLNRERPTSGNSA
3e8qA           ------------------------------------NLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAK
3e8zA           VDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGT-ISVVLGGDHSMAIGSISGHARVHPDLCVIWVD
3cvxA           VRPIFILDPGILDWMQVGRFLQQTLEDLDNQLRKLNSR-LFVVRGKPAEVFPRIFKSWRVEMLTFETDIE
2cukA           -------------------VTRTLPGKALDRLRERGLE-VEVHRGLFLPKAELLKRVEGAVGLIPTVEDR
2a1uA           -------QSTLVIAEHANDSLAPITLNTITAATRLGGEVSCVAGTKCDKVAQDLCKVAGIAKVLVGLLPE
2a0mA           -------------------VIGGGNDQNGRAMLRAFPGDVGVINVDSDVRPPLQDGRVHSGTPFRQLLEE
3d1rA           TRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNVAAALGKPLSELTVTIL
1efvA           ------------IAEHANDSLAPITLNTITAATRLGGESCLVAGTKCDKVAQDLCKVAGIAKVLVGLLPE
3e6kA           ------------------------------------------------------PDVPGFSWVTPCISAK
2bz0A           GILLYALQDQGYDTVEGFAADERDFTLCADMFKLLGV-NEVRLLTNNPKKVEILT-EAGINIVERVPLI-
1d3vA           -------PFQIVKNPRSVGKANEQLAAVVAETQKNGTI-SVVLGGDHSMAIGSISGHARVHPDLCVIWVD
1e5rA           ----------------------------------------------------------------------
2ejbA           ------------CITGASGVIY--GIKLLQVLEELDFS-VDLVISRNAKVVLKEEVLKGLKNVRIHEEN-
2cg9B           ----------LRYNSTKSVDELTSLTDYVTRMPEHQKNIY-YITGESLKAVEKSPFLDALKAKNFEVLKD
2bz1A           GILLYHGYDTVEANHQLGFAADERDFTLCADFKLLGV-NEVRLLTNNPKKVEILT-EAGINIVERVPLI-
3ddhB           ADIIRQIVDLGKSLLKPIELLP-GVKETLKTLKETGKYKLVVATKGDLLDQENKLERSGLSPYFDHIEVS
2e6gJ           -----------------DGIYSPGLWALAEAASQFGEV-FVAAPDAHPVRAYPHPSPPHFPAYRVRGTPA
2a1tR           ------FQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVGTKCDKVAQDLCKVAGIAKVLVAQHPE
2cftA           RDVLGRAQGVLFGVLWNGERAVPGAPELLERLARAGKA-ALFVSNNSRRARPELALRFARGGLRAEQLFS
1dyrA           -----------------PWKLKKEISFKRVTSFVPTFDMNVVLMGRKTWESIPLQFRPLKNVVITRNESL
2cfsA           ------------GVLWNGERAVPGAPELLERLARAGKA-ALFVSNNSRRARPELALRFAFGGLRAEQLFS
4cd2A           ----------------------------------------------------------------------
3bjzB           ------------------------------------TTDSSYNEVFSKQIRALGQPGDVLLAISTSGNSA
3cnhA           -----DFTPEDFRAVEEQSQPRPEVLALARDLGQRYR---YSLNNEGRDLNEYRIRTFGLGEFLLAFFTS
3dv9A           -----------------------GALEVLTKIKSEGLTPV-VTGSGLLDRLNHNFPGIFQANLVTDVKYG
3e59B           ------------------QVQLPRIAAFIEAGEPIEFV-LPAFPAKSPNPGKVLDSRPDMAERLSLSFLN
2aebA           PFADIPNDSPFQIVKNPRSVGKASEQLAVAEVKKNGR-ISLVLGGDHSLAIGSISGHARVHPDLGVIWVD


                         *         .         .         .         .         +         .:560
query           DKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK
3b8cA           HKYEIVKKLQER---KHIVGMTGDGVNDAPALKKADIGIAV-ADATDAARGASDIVLTEPGLSVIISAVL
3ba6A           --KMFVKGAPEGVIDRCNYVRVTTRVPMTGPVKEKILSVIKEWGTGRDTLRCLALA-TRDTPPKREEMVL
3a1dA           ----QKSEEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3a1eA           QKSEEVKKLQ----AKEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3a1cA           QK----SEEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
2b8eC           QKSEEVKKLQ----AKEVVAFVGDGINDAPALAQADLGIAV-------GSGSGDIVLIRDDLRDVVAAIQ
3a1dB           HQKSEEVKKLQ---AKEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
2b8eA           QKSEEVKKLQ----AKEVVAFVGDGINDAPALAQADLGIAVGS---------GDIVLIRDDLRDVVAAIQ
3a1eB           QK----SEEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVG-SGSDVAVESGDIVLIRDDLRDVVAAIQ
2b8eB           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGD-IVLIRDDLRDVVAAIQ----------
2amyA           GWDKRYCLRHVENDGYKTIYFFGDKTNDHEIFTDPRTGYSVTA-PEDTRRICELLF--------------
3a1cB           QK----SEEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3daoA           SKWTALSYLIDRFDLPDEVCCFGDNLNDIELQN-AGISYAVSN-ARQEVIAAAKHTCAPYWENGVLSVLK
2dfaA           RSGQLAPRSM----PGSWITDPEEAARRALRMVLEGKVEALD--GGEVAVRADTLCIHPNAPEVARAVRE
3b8eA           QKLIIVEGCQR---QGAIVAVTGDGVNDSPASKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVE
3daoB           SKWTALSYLIDRFDLPDEVCCFGDNLNDIELQN-AGISYAVSN-ARQEVIAAAKHTCAPYWENGVLSVLK
3bigA           RHDAVIAEMQQLGVRVIPDGDVAASILTCMPDSEVDVLYGIGG-APEGVVSAAVIRALDGDMNGRLLARH
2cfrA           SGRQALVVGKPSPYDPARTLVGDRLETDILFGHRCGTTVLTLT-GVSRLEEAQAYLAAGQHDLVPHYYVE
2b30A           DKYTGINYLLKHYNSNDQVLVVGDAENDIAMLSNFKYSFAVAN-ATDSAKSHAKCVLPVSHREGAVAYLL
3bihA           AKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMDVLYGIGG-APEGVVSAAVIRALDGDMNGRLLARH
2b8nA           KKPAALIFGGETV-----VHVKGNGIGGRN--QELALSAAIALEGIEGVILCSAGTIVDGSTAKTLKAGE
3c0bD           KLAEVLKTYSND---VSHVALVTEGVDNILNAAESAFGSNIDSNGNFISLESAKTNNKVSASNWCGTAKW
2b82A           PGQNTKSQWLQD---KNIRIFYGDSDNDITAARDVGIRILRASNSTYKPLPQAGAFGEEVI---------
3c8sA           AEKQDVDAAVRGILRNAKLKPVYDSLDAVRECALINMVFQMG-ETGVAGFTNSLRMLQQKRWDEAAVNLA
2cllA           TGHHLIEKLKEYH---AAPALQGFGISSPEQVSAAVRAGAAGAISGSAEKNLASPKQMLAELRSFVSAMK
152lA           AEKQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMG-ETGVAGFTNSLRMLQQKRWDEAAVNLA
3c82A           AEKLDVDAAVRGILRNAKLAPVYDSLDAVRHCALINMVFQMGE-TGVAGFTNSLRMLQQKRWDEAAVNLA
250lA           QDVDAAVRGIL---RNAKLKPVYDSLDAVRRAALINMVFQMGETGSLRMLQQKRWDEAAVNLAKSRWYNQ
2autB           PVIFAGDKPEQNTNVQNMRIFYGDSDNDITAARDCGIRILRAANSTYKPLPFGEEVIVNSE---------
3c8qA           QDVDAAVRGILR---NAKLKPVYDSLDAVRDCALINMVFQMGE-TGVAGFTNSLRMLQQKRWDEAAVNLA
3c81A           QDVDAAVRGILR---NAKLAPVYDSLDAVRRCALINMVFQM-GETGVAGFTNSLRMLQQKRWDEAAVNLA
2a8iA           FSLAAFKRNKRKLEDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGHNPYSTAVS
1eexG           ----------------------------------------------------------------------
3e81A           AAEELCNELGI---NLEQVAYIGDDLNDAKLLKRVGIAGVPAS-APFYIRRLSTIFLEKRGGEGVFREFV
2b0cA           IYQHVLQAEGF---SPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV---------------
1aq6A           SYALVEEVLGV---TPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQEALARELVSGTIAPLTMFKALRM
170lA           QDVDAAVRGIL---RNAKLKPVYDSLDAVRRSALINMVFQMGE-TGVAGFTNSLRMLQQKRWDEAAVNLA
2autA           PVIFAGDKPEQNTNVQNMRIFYGDSDNDITAARDCGIRILRAANSTYKPLPQAGAFGEE-----------
2cn1A           FMDFDETGYFNQLKDNSNIILLGDSQGDADGVANVEHILKIGYLNLEKYMDSYDIVLVQDESLEVANSIL
2c34A           ----------------------------------------------------------------------
2autD           PVIFAGDKPEQNTQEKNMRIFYGDSDNDITAARDCGIRILRAANSTYKPLPQAGAFGE------------
3cvwA           PYSVTRAAVQKLAKAEGRVETHCSHTIYNPELVIAKNLGKA-----------------------------
3e58B           IYLTALKQLNV---QASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGDQSAAKGLL--DSLTDVLDLI-
3bjzD           NVIQAIQAAHD---RELVVALTGRDGGGASLLLPEDVEIRVPSKITARIQEVHLLAIHCL----------
3dnpA           SKEAGLALVASELGLSDDVVAIGHQYDDLP-IELAGLGVAGNA--VPEIKRKADWVTRSNDEQGVAYKEY
2bduA           LKNTDYFSQLKD---NSNIILLGDSQGDLRADGVANVEHILKVDELLEKYDSYDIVLVKEESLEVVNSIL
3e58A           IYLTALKQLNV---QASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGDQSAAKGLL--DSLTDVLDLI-
3bjzA           NVIQAIQAAHD---RELVVALTGRDGGGASLLLPEDVEIRVPS-KITARIQEVHLLAIHCLCDLIDRQL-
3bjzC           NVIQAIQAAHDREL---VVALTGRDGGGASLLLPEDVEIRVPSKITARIQEVHLLAIH------------
3e8qA           DIVYIGLRDVDPGEHY-IIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFT
3e8zA           AHTDIATPEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSLLGRKKRPIHLSFDVDGLDPVFTPATGTPV
3cvxA           YSVTRDAAVQKLAKAEGVVETHCSTIYNPELVIAKNLGKAPI-TYQKFLGIVEQLKVPKVLGVEKLKNMP
2cukA           IDAEVMDRAKGL----KVIACYSVGVDHVDLEAARERGIRVTH-TPGVLTEATADLTLALLLAVARRVVE
2a1uA           ELTPLILATQKQFNYTHIAGASAFGKNLLPRVAAKLVAPISDIIAIKSPDTFVRTIYAGNALCT----VK
2a0mA           SSFSGKRFVEFACQ---GSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAAFSFDVDSLKSSDMPGVSCPA
3d1rA           AKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSLYGIGGAPEGVVSAAVIRALDGDMNGRLLARH
1efvA           ELTPLILATQKQFNYTHICAASAFGKNLLPRVAAKL---EVAPISDIIAIKSPDTFVRTIYAGNALCTVK
3e6kA           DIVYIGLRDVAPKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPV
2bz0A           ----------------------------------------------------------------------
1d3vA           AHTDINTPLTTSSELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIK-----YFSMTE
1e5rA           ----------------------------------------------------------------------
2ejbA           --------DFTSPLASGSRLVHYRGVYVVPCSTNTLSCIAN-GINKNLIHRVGEVALKERVPLVLVREAP
2cg9B           FELEETKALKEILGDQVEKVVVYKLLDAPAAIRTGQFGWSA---NMERIMKAQAKTFE-ISPKS-PIIKE
2bz1A           ----------------------------------------------------------------------
3ddhB           DKTEKELRLLSILQIAPSLLVGNSFKSDIQPVLSLGGYGVHI-PFEETFAHERLKQV-------------
2e6gJ           DCVALGLHL------FGPVDLVLSGVNLGSIWHSGTVAAAKQGYL-FGLSAAAFSVPLNGEVPDF-----
2a1tR           ELTPLILATQKQFNYTHCAGASAFGKNLLPRVAAKL---EVAPISDIIAIKSPDTFVRTIYAGNALCTVK
2cftA           SALCAARLLRQRLGPPDGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAAPRVRAVLHFSFAKLREACAH
1dyrA           DLGNGIHSAKSL---DHALELLYRTYGSESSVQINRIFVIG---GAQLYKAAMDHPKLDRIMATIIYKDI
2cfsA           SALCAARLLRQRLGPPGAVFLGGEGLRAE--LRAAGLRLAGDSAGDGAAPRVRAVLVGYDEAKLREACAH
4cd2A           --------------------LLYRTYGSESSVQINRIFVIGG---AQLYKAAMDHPKLDRIMATIIYKDI
3bjzB           NVIQAIQAAHD---RELVVALTGRDGGGASLLLPEDVEIRVPSKITARIQEVHLLAIHCL-CDLIDRQLF
3cnhA           SALGVYRLGLTLAQVRPEEAVVDDRLQNVQAARAVGHAVQCVDAAQLRE-ELAA----------------
3dv9A           KPNPEPYLALKKGGFKPNALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVGANLLFHSPDFNKNWETLQ
3e59B           HLCQRIQLFYAP---GAKITVCSDG-RVFGDLVRIGDAHIS-AYQDALRLMIEEIGAT------------
2aebA           AHTDINTPLTTTSGN--LHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKT


                         .         .         .         *         .         .         .:630
query           IARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFADVGVTFIAILNALRLLKMKEENKKINKYPH
3b8cA           TSRAIFQRMKNYTIYAVSITXXXXXXXXXXXXXXXXXXXXXXXL-IIAILNDGTIMTISKDRVKPSPTP-
3ba6A           DDSSRFMEYETDLTFVGVVGMLDPPRRDAGIRVIMIT--GDNKGTAIAICRRIGIFGENEEVADRAYTGR
3a1dA           LSRK------------------------------------------------------------------
3a1eA           LSRK------------------------------------------------------------------
3a1cA           LSR-------------------------------------------------------------------
2b8eC           LSRKT-----------------------------------------------------------------
3a1dB           LSRKT-----------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
3a1eB           LSRKT-----------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2amyA           ----------------------------------------------------------------------
3a1cB           LSRKT-----------------------------------------------------------------
3daoA           ----------------------------------------------------------------------
2dfaA           ALEQA-----------------------------------------------------------------
3b8eA           EGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGPAISLAYEQAESDIMKRQPR
3daoB           ----------------------------------------------------------------------
3bigA           DVKNEENRRIGEQELARCKAMGIEAGKVLRLGDMDNVIFSATGITKGDLLEGISRKG-------------
2cfrA           SIADL-----------------------------------------------------------------
2b30A           ----------------------------------------------------------------------
3bihA           DVKNEENRRIGEQE-LARCKAMGIEAGKVLRLGDMARS-DNVIFSATGITKGDLLEGISRK---------
2b8nA           DPYQYLKNNDSYNALKKSGALLITG---------------------------------------------
3c0bD           VSKNIEENCILVDGSTTTDIIPIVEGKVVAEKTDLERLNHELLYVGTLRTPISHLGNTISF-KGVDTNVS
2b82A           ----------------------------------------------------------------------
3c8sA           KSRWYNQTPNRAKRVITTFR--------------------------------------------------
2cllA           AASR------------------------------------------------------------------
152lA           KSRWYNQCPNRAKRVIT-----------------------------------------------------
3c82A           KSRWYNQTPNRAKRVITTFRTGTWDAY-------------------------------------------
250lA           TPNRAKRVIT------------------------------------------------------------
2autB           ----------------------------------------------------------------------
3c8qA           KSRWYNQTPNRAKRVI------------------------------------------------------
3c81A           KSRWYNQTPNRAKRVIT-----------------------------------------------------
2a8iA           TSGCGEHLVRTILAREC-----------------------------------------------------
1eexG           ----------------------------------------------------------------------
3e81A           -EKVLGINLEDFIAVI------------------------------------------------------
2b0cA           ----------------------------------------------------------------------
1aq6A           REETYAEAVVPALGDLPRL---------------------------------------------------
170lA           KSRWY-----------------------------------------------------------------
2autA           ----------------------------------------------------------------------
2cn1A           ----------------------------------------------------------------------
2c34A           ----------------------------------------------------------------------
2autD           ----------------------------------------------------------------------
3cvwA           ----------------------------------------------------------------------
3e58B           ----------------------------------------------------------------------
3bjzD           ----------------------------------------------------------------------
3dnpA           FRQQRK----------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
3e58A           ----------------------------------------------------------------------
3bjzA           ----------------------------------------------------------------------
3bjzC           ----------------------------------------------------------------------
3e8qA           PATGTEEIYKTGLLSGLDIMEVNPTLGKTPEERTVNTAVALTLSCFGTKREGNH----------------
3e8zA           VGGLSYREGLYITEEIYKTGLLSGLDTPEEVTRTVNTAVALTLSCFGTKREG------------------
3cvxA           TPPKDEVEQKDSAAYDC-----------------------------------------------------
2cukA           YARDGLWKAWPELLLGLDLQGLTLLVGMGRIGQAVAKRALAFGMRVVY----------------------
2a1uA           CDEKVKVFS-------------------------------------------------------------
2a0mA           AVGLSAQEAFDMCFLAGKTPTVMMMDMSELNPLVEEYRSPRVAVYM--FYHFVLGFATR-----------
3d1rA           DVKGDNENRRIGELARCKAKVLRLMARSDNVIGITKGDLLEGISNIARGKSTIRRIQ-------------
1efvA           CDEKVKVF--------------------------------------------------------------
3e6kA           VGGLTYREGLYITEEIYKTGLLSGLDPSLGKTPEEVTRTVNTAVAITLAC-FGL----------------
2bz0A           ----------------------------------------------------------------------
1d3vA           VDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGT--------------------------
1e5rA           ----------------------------------------------------------------------
2ejbA           YNEIHLENMLKITRMG--GVVVPASPAFYHKPQSIDDMINFVVGK---LLDVLRI---------------
2cg9B           LKKRVDEGGAQDKTVKDLTKLLY-----------------------------------------------
2bz1A           ----------------------------------------------------------------------
3ddhB           ----------------------------------------------------------------------
2e6gJ           ----------------------------------------------------------------------
2a1tR           CDEKVKVFS-------------------------------------------------------------
2cftA           LRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETAS-------------------------------
1dyrA           HCDVFFPLKFRDKEWSSVWKKEK-----------------------------------------------
2cfsA           LRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETAS-------------------------------
4cd2A           HCDVFFPLKFRDKEWSSVWKKEK-----------------------------------------------
3bjzB           ----------------------------------------------------------------------
3cnhA           ----------------------------------------------------------------------
3dv9A           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2aebA           LGIKYFSMTEDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDG----------------------------


                         .         +         .         .         .         .         *:700
query           SKTEKYKVEVNEA
3b8cA           -------------
3ba6A           EFDDLPLAEQREA
3a1dA           -------------
3a1eA           -------------
3a1cA           -------------
2b8eC           -------------
3a1dB           -------------
2b8eA           -------------
3a1eB           -------------
2b8eB           -------------
2amyA           -------------
3a1cB           -------------
3daoA           -------------
2dfaA           -------------
3b8eA           NPKTD--------
3daoB           -------------
3bigA           -------------
2cfrA           -------------
2b30A           -------------
3bihA           -------------
2b8nA           -------------
3c0bD           S------------
2b82A           -------------
3c8sA           -------------
2cllA           -------------
152lA           -------------
3c82A           -------------
250lA           -------------
2autB           -------------
3c8qA           -------------
3c81A           -------------
2a8iA           -------------
1eexG           -------------
3e81A           -------------
2b0cA           -------------
1aq6A           -------------
170lA           -------------
2autA           -------------
2cn1A           -------------
2c34A           -------------
2autD           -------------
3cvwA           -------------
3e58B           -------------
3bjzD           -------------
3dnpA           -------------
2bduA           -------------
3e58A           -------------
3bjzA           -------------
3bjzC           -------------
3e8qA           -------------
3e8zA           -------------
3cvxA           -------------
2cukA           -------------
2a1uA           -------------
2a0mA           -------------
3d1rA           -------------
1efvA           -------------
3e6kA           -------------
2bz0A           -------------
1d3vA           -------------
1e5rA           -------------
2ejbA           -------------
2cg9B           -------------
2bz1A           -------------
3ddhB           -------------
2e6gJ           -------------
2a1tR           -------------
2cftA           -------------
1dyrA           -------------
2cfsA           -------------
4cd2A           -------------
3bjzB           -------------
3cnhA           -------------
3dv9A           -------------
3e59B           -------------
2aebA           -------------