[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00490.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a6iA.bssp"
#ERROR : Can't open dsspfile "2dg7A.bssp"
#ERROR : Can't open dsspfile "1bj0A.bssp"
#ERROR : Can't open dsspfile "1du7A.bssp"
#ERROR : Can't open dsspfile "3bruA.bssp"
#ERROR : Can't open dsspfile "1bjzA.bssp"
#ERROR : Can't open dsspfile "3c2bB.bssp"
#ERROR : Can't open dsspfile "3bniB.bssp"
#ERROR : Can't open dsspfile "2dg8D.bssp"
#ERROR : Can't open dsspfile "1bjyB.bssp"
#ERROR : Can't open dsspfile "2dg8A.bssp"
#ERROR : Can't open dsspfile "3b6cA.bssp"
#ERROR : Can't open dsspfile "3cjdB.bssp"
#ERROR : Can't open dsspfile "3e7qA.bssp"
#ERROR : Can't open dsspfile "3colA.bssp"
#ERROR : Can't open dsspfile "3c2bA.bssp"
#ERROR : Can't open dsspfile "2dg8B.bssp"
#ERROR : Can't open dsspfile "3bniA.bssp"
#ERROR : Can't open dsspfile "3cjdA.bssp"
#ERROR : Can't open dsspfile "3cwrA.bssp"
#ERROR : Can't open dsspfile "3cwrB.bssp"
#ERROR : Can't open dsspfile "3ccyA.bssp"
#ERROR : Can't open dsspfile "3e7qB.bssp"
#ERROR : Can't open dsspfile "3bruB.bssp"
#ERROR : Can't open dsspfile "3b81A.bssp"
#ERROR : Can't open dsspfile "3b6aA.bssp"
#ERROR : Can't open dsspfile "3cdlA.bssp"
#ERROR : Can't open dsspfile "2dg8C.bssp"
#ERROR : Can't open dsspfile "3bjbE.bssp"
#ERROR : Can't open dsspfile "3dcfA.bssp"
#ERROR : Can't open dsspfile "3dpjF.bssp"
#ERROR : Can't open dsspfile "2eh3A.bssp"
#ERROR : Can't open dsspfile "3bhqA.bssp"
#ERROR : Can't open dsspfile "3b6cB.bssp"
#ERROR : Can't open dsspfile "3dpjE.bssp"
#ERROR : Can't open dsspfile "3dpjA.bssp"
#ERROR : Can't open dsspfile "3colB.bssp"
#ERROR : Can't open dsspfile "3bjbB.bssp"
#ERROR : Can't open dsspfile "3btiB.bssp"
#ERROR : Can't open dsspfile "3bt9B.bssp"
#ERROR : Can't open dsspfile "3c07A.bssp"
#ERROR : Can't open dsspfile "3dcfB.bssp"
#ERROR : Can't open dsspfile "3bjbC.bssp"
#ERROR : Can't open dsspfile "3br0A.bssp"
#ERROR : Can't open dsspfile "3bjbF.bssp"
#ERROR : Can't open dsspfile "3dewA.bssp"
#ERROR : Can't open dsspfile "3br0B.bssp"
#ERROR : Can't open dsspfile "3b6aB.bssp"
#ERROR : Can't open dsspfile "3br5E.bssp"
#ERROR : Can't open dsspfile "3dpjB.bssp"
#ERROR : Can't open dsspfile "3c07B.bssp"
#ERROR : Can't open dsspfile "3br6A.bssp"
#ERROR : Can't open dsspfile "3br5D.bssp"
#ERROR : Can't open dsspfile "3br3A.bssp"
#ERROR : Can't open dsspfile "3cdlB.bssp"
#ERROR : Can't open dsspfile "3crjA.bssp"
#ERROR : Can't open dsspfile "3bjbA.bssp"
#ERROR : Can't open dsspfile "3br2A.bssp"
#ERROR : Can't open dsspfile "3bqzA.bssp"
#ERROR : Can't open dsspfile "3crjD.bssp"
#ERROR : Can't open dsspfile "3crjB.bssp"
#ERROR : Can't open dsspfile "3br5A.bssp"
#ERROR : Can't open dsspfile "2dtzD.bssp"
#ERROR : Can't open dsspfile "3br2E.bssp"
#ERROR : Can't open dsspfile "3br3B.bssp"
#ERROR : Can't open dsspfile "3br2D.bssp"
#ERROR : Can't open dsspfile "2dtzB.bssp"
#ERROR : Can't open dsspfile "2dt5A.bssp"
#ERROR : Can't open dsspfile "3br1D.bssp"
#ERROR : Can't open dsspfile "3bqzB.bssp"
#ERROR : Can't open dsspfile "2d6yA.bssp"
#ERROR : Can't open dsspfile "2d6yB.bssp"
#ERROR : Can't open dsspfile "3bqyA.bssp"
#ERROR : Can't open dsspfile "3egqB.bssp"
#ERROR : Can't open dsspfile "3egqA.bssp"
#ERROR : Can't open dsspfile "3br5B.bssp"
#ERROR : Can't open dsspfile "3bjbD.bssp"
#ERROR : Can't open dsspfile "3br2B.bssp"
#ERROR : Can't open dsspfile "3br1B.bssp"
#ERROR : Can't open dsspfile "1aerB.bssp"
#ERROR : Can't open dsspfile "3br6B.bssp"
#ERROR : Can't open dsspfile "2bjcA.bssp"
#ERROR : Can't open dsspfile "1cjgA.bssp"
#ERROR : Can't open dsspfile "3crjC.bssp"

## Summary of PDB Search
:197
    3e-19  16%  1a6iA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS D
    4e-19  16%  2dg7A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    6e-19  18%  1bj0A  [x.x.x] TETRACYCLINE REPRESSOR
    6e-19  16%  1du7A  [a.4.1 - a.121.1] PROTEIN (TETRACYCLINE REPRESSOR PROTEIN
    2e-18  17%  3bruA  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    3e-18  19%  1bjzA  [x.x.x] TETRACYCLINE REPRESSOR
    2e-17  12%  3c2bB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-17  13%  3bniB  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    5e-17  14%  2dg8D  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    7e-17  16%  1bjyB  [a.4.1 - a.121.1] TETRACYCLINE REPRESSOR
    9e-17  14%  2dg8A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    2e-16  12%  3b6cA  [x.x.x] ACTII PROTEIN
    2e-16  11%  3cjdB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    3e-16  16%  3e7qA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    4e-16  16%  3colA  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    5e-16  13%  3c2bA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    8e-16  14%  2dg8B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    9e-16  13%  3bniA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-15  11%  3cjdA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-15  16%  3cwrA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-15  17%  3cwrB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-15  12%  3ccyA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-15  16%  3e7qB  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-15  18%  3bruB  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    3e-15  12%  3b81A  [x.x.x] TRANSCRIPTIONAL REGULATOR, ACRR FAMILY
    5e-15  10%  3b6aA  [x.x.x] ACTR PROTEIN
    7e-15  11%  3cdlA  [x.x.x] TRANSCRIPTIONAL REGULATOR AEFR
    1e-14  14%  2dg8C  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    2e-14  11%  3bjbE  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-14  15%  3dcfA  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    3e-14  17%  3dpjF  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    3e-14  21%  2eh3A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-14  15%  3bhqA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-14  12%  3b6cB  [x.x.x] ACTII PROTEIN
    4e-14  15%  3dpjE  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    5e-14  23%  3dpjA  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    7e-14  17%  3colB  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    9e-14  11%  3bjbB  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-13  16%  3btiB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-13  16%  3bt9B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-13  14%  3c07A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    3e-13  15%  3dcfB  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    3e-13  12%  3bjbC  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    4e-13  13%  3br0A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    5e-13  10%  3bjbF  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    5e-13  15%  3dewA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    8e-13  12%  3br0B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    8e-13  14%  3b6aB  [x.x.x] ACTR PROTEIN
    8e-13  14%  3br5E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-12  23%  3dpjB  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    1e-12  14%  3c07B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-12  15%  3br6A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-12  12%  3br5D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-12  16%  3br3A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-12  12%  3cdlB  [x.x.x] TRANSCRIPTIONAL REGULATOR AEFR
    4e-12  22%  3crjA  [x.x.x] TRANSCRIPTION REGULATOR
    5e-12  23%  3bjbA  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    5e-12  16%  3br2A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-11  14%  3bqzA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-11  22%  3crjD  [x.x.x] TRANSCRIPTION REGULATOR
    1e-11  22%  3crjB  [x.x.x] TRANSCRIPTION REGULATOR
    2e-11  10%  3br5A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-11  14%  2dtzD  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-11  15%  3br2E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-11  12%  3br3B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-11  15%  3br2D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-11  11%  2dtzB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-11   6%  2dt5A  [x.x.x] AT-RICH DNA-BINDING PROTEIN
    6e-11  14%  3br1D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    8e-11  14%  3bqzB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-10  13%  2d6yA  [x.x.x] PUTATIVE TETR FAMILY REGULATORY PROTEIN
    1e-10  13%  2d6yB  [x.x.x] PUTATIVE TETR FAMILY REGULATORY PROTEIN
    1e-10  32%  3bqyA  [x.x.x] PUTATIVE TETR FAMILY TRANSCRIPTIONAL REGULATOR
    1e-10  13%  3egqB  [x.x.x] TETR FAMILY TRANSCRIPTIONAL REGULATOR
    1e-10  15%  3egqA  [x.x.x] TETR FAMILY TRANSCRIPTIONAL REGULATOR
    6e-10  12%  3br5B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-09  28%  3bjbD  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    4e-09  12%  3br2B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-08  14%  3br1B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-08  10%  1aerB  [d.166.1] EXOTOXIN A
    8e-08  12%  3br6B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    6e-07  18%  2bjcA  [x.x.x] LACTOSE OPERON REPRESSOR
    8e-07  19%  1cjgA  [a.35.1] PROTEIN (LAC REPRESSOR)
    8e-06  11%  3crjC  [x.x.x] TRANSCRIPTION REGULATOR
:197

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxDLRVRKTRAKIKRALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQLEEAIYSDII
1a6iA           --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARHH
2dg7A           ------WDPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFPDKREVLFGGSELLPPAVA
1bj0A           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHH
1du7A           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHH
3bruA           --------SLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFA
1bjzA           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHH
3c2bB           --------SPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAITFQQSKVDR
3bniB           ---------ERLTRILDACADLLDEVGYDALSTRAVALRADVPIGSVYRFFGNKRQMADALAQRNLERYA
2dg8D           ---------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
1bjyB           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHH
2dg8A           ---------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
3b6cA           --------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV-
3cjdB           ----------LREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARLG
3e7qA           ------EPEQRKALLIEATLACLKRHGFQGASVRKICAEAGVSVGLINHHYDGKDALVAEAYLAVTGRVM
3colA           ----------KQVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRIL
3c2bA           ----------RQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAITFQQSKVRT
2dg8B           ---------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
3bniA           ------RSAERLTRILDACADLLDEVGYDALSTRAVALRADVPIGSVYRFFGNKRQMADALAQRNLERYA
3cjdA           ---------ALREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARLG
3cwrA           ------PDAVVRESIVGAAQRLLSSGGA--AATEGVASEAGIAKKTLYRFASGRADLIGLLVESWIAPIF
3cwrB           --------AVVRESIVGAAQRLLSSGGA--AATEGVASEAGIAKKTLYRFASGRADLIGLLVESWIAPIF
3ccyA           ---------NIRDTIIERA-AAFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLRDLTTHVDSLLE
3e7qB           ------EPEQRKALLIEATLACLKRHGFQGASVRKICAEAGVSVGLINHHYDGKDALVAEAYLAVTGRVM
3bruB           ----------AHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFA
3b81A           -----INFNNKRTELANKIWDIFIANGYENTTLAFIINKLGISKGALYHYFSSKEECADAAIENRVAFFS
3b6aA           --------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV-
3cdlA           --------DQKRESIVQAAIAEFGDRGF-EITSDRIAARAEVSKRTVYNHFPSKEELFAELQRLWNCAEV
2dg8C           ---------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
3bjbE           ------EEQRARHVRLEAAIELATEKELARVQH-EVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGVP
3dcfA           ----------RRTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAIVNSIVDEAL
3dpjF           ---------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
2eh3A           ----------TKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKII
3bhqA           ------RSARKDREIIQAATAAFISKGYDG-TSEEIATKAGASKQTVYKHFTDKETLFGEVVLSTASQVN
3b6cB           --------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV-
3dpjE           ----NAVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
3dpjA           ------VQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
3colB           -----------QVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRIL
3bjbB           --------QRARHVRLEAAIELATEKELARVQH-EVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGVG
3btiB           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILN-IEQSKW
3bt9B           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILN-IQESKW
3c07A           ---------EQTRALILETARLFQERGYDR-TTRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAEHR
3dcfB           ----------RRTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAIVNSIVDEAL
3bjbC           ---------RARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRG--
3br0A           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEIESKWQEQWK
3bjbF           --------QRARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGVG
3dewA           -----------CRSRLEVATELFAQKGFYGVSIRELAQAAGASISISY-HFGGKEGLYAAVLQEQFACFG
3br0B           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQ
3b6aB           --------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV-
3br5E           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQ
3dpjB           ---------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
3c07B           ---------EQTRALILETARLFQERGYDR-TTRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAEHR
3br6A           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
3br5D           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQ
3br3A           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
3cdlB           --------DQKRESIVQAAIAEFGDRGF-EITSDRIAARAEVSKRTVYNHFPSKEELFAELQRLWNCYRP
3crjA           ------RTFSDQTEEIQATYRALREHGYADLTIQRIADEYGKSTAAVHYYYDTKDDLLAAFLDYLLERFV
3bjbA           ------EEQRARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGES
3br2A           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
3bqzA           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
3crjD           ----------DQTEEIQATYRALREHGYADLTIQRIADEYGKSTAAVHYYYDTKDDLLAAFLDYLLERFV
3crjB           ----------DQTEEIQATYRALREHGYADLTIQRIADEYGKSTAAVHYYYDTKDDLLAAFLDYLLERFV
3br5A           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQ
2dtzD           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
3br2E           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
3br3B           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQ
3br2D           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
2dtzB           ----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLFKTKENLFLEILNIEESKWQEQW
2dt5A           ------EAAISRLITYLRILEELEAQGVHRTSSEQLGGLAQVTAFQVRKDLSYFGSYGTRGVGYTVPVLK
3br1D           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
3bqzB           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLILNIEESKWQEQW
2d6yA           ---------ATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKLDLAI
2d6yB           --------EATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKLDLAI
3bqyA           -----------RARTVQTALDLLNESGLDTLTRRLA--QADVQAGALYRYFAAKQDLLTAAEH-------
3egqB           ----------QSVRIIEAALRLYKKPPHE-VSIEEIAREAKVSKSLIFYHFESKQKLLEEAVHAFRKEEF
3egqA           ----------QSVRIIEAALRLYKKPPHE-VSIEEIAREAKVSKSLIFYHFESKQKLLEEAVHAFRKEEF
3br5B           -----------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYFKTKENLFLILNIEESKWQEQW
3bjbD           -----------RHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQI-----
3br2B           -------------KILGVAKELFIKNGYNATTTGEIVKLSESSKGNLY-TKENLFLEILNIEESKWQEQW
3br1B           -------------KILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYFKTKENLFLILNIEESKWQEQW
1aerB           ------QDLDAIWRGFYIAGDPALAYGY---AQDQEPDRGRIRNGALLRVYVPRSSLPGFYRTSLTLAA-
3br6B           -----------KDKILGVAKELF-INGYNATTTGEIVKLSESSKGNLYFKTK-ENLFLEILN---IEESK
2bjcA           -----------------------------PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAMA
1cjgA           -----------------------------PVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMA
3crjC           ------------------------YRALRDLTIQRIADEYS--TAAVHYYYDTKDDLLAAFLDYLLERFV


                         .         .         *         .         .         .         .:140
query           QLFHDNGTISSATSYEDLNRQFFQKFSAYIYGERYFILAIVLGNGDPMFYHKIKQILTRELLKRMEYLGI
1a6iA           DYSLP---AAGESWQSFL-RNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFNGFSLRDGLYA
2dg7A           RLAADPG----AAPLTAV-LDASQVGAQLVAQVEGAAQRRAVIDASPELQERERTKSISRAVQDALVRR-
1bj0A           DYSLP----AAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQL-RFMTENGFSLRD
1du7A           DYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGLYAISAVSH-
3bruA           RLLDQLDGSLAPLARLRLFTRAEEGARHGFRRGCLVGNLGQEGALPDDFRAALIGVRTAQLFREAQACG-
1bjzA           DYSLP---AAGESWQSFL-RNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFSLRDGLYAIS-
3c2bB           VSAPQ--LADHLEVFAHDLLDVLAGDVSLALNRLAIGQASRDGSKGDLLLERGRRQIARGLIEAGRRSG-
3bniB           ERVTERLTEAGDGGWRGALDTVLDEYLAMKRTAPGFSLIDFGHRVAERLTELLSGYLGRLVAVETADTL-
2dg8D           AVFDE--HLGAAADRDEAREAVADLVHELSEDSQRDLVLTQELYTLAARQPAYRELT-HEWMRRSR----
1bjyB           DYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGLYAISAVSH-
2dg8A           AVFDE--HLGAAADRDEAREAVADLVHELSEDSQRDLVLTQELYTLAARQPAYRELT-HEWMRRSR----
3b6cA           -EVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDEL----
3cjdB           AAVGA------VDHPNER-LIASHAYLAFAREHPKLWRALFDVERSDGPVPQWYGHAAQLFSYITTPLAK
3e7qA           RLLRGAIDTAPGGARPRL-SAFFEASFSAELLDPQLLDAWLAFWGAVGSIEAIGRVHDHSYGEYRALLVG
3colA           STTDLDRLSDSTIDVTTRIRLYVQQVYDYSLANPDSLTIIQQIKALNGQDADPNNIVANLLTAAIDAKVI
3c2bA           FEKAG--DRVSAPQLADHLEVFAHDLLDVLDVSLALNRLAIGQASRKLGDLLLRQIRARGLIEAGRRSG-
2dg8B           AVFDE--HLGAAADRDEAREAVADLVHELSEDSQRDLVLTQELYTLAARQPAY-----RELTHEWMRRSR
3bniA           ERVTERLTEAGDGGWRGALDTVLDEYLAMKRTAPSLIDFGRVAERLTELLSGYLGRRPDDDLRRVFLVTA
3cjdA           AAV--------GDDHPNERLIASHAYLAFAREHPKLWRALFDVERSDGPVPQWYGHAAQLFSYITTPLAK
3cwrA           PGFEA--DPQDAAAALERIVYDIAQAVLSREAVSLFRLASDADLRNRFLPAYNANGIEARWLDQQASAG-
3cwrB           PEADP---QDAAAALERIVYDIAQAVLSR-EAVSLFRLASDADLRNRFLPAYNANGIEARWLDQQASAG-
3ccyA           RCRQV---LYGSNEPKTRFLQIVKLFLEIYATSRDRHVVLTLDALPEDQRKALIAKQRELIAYVRDALLQ
3e7qB           RLLRGAIDTAPGGARPRL-SAFFEASFSAELLDPQLLDAWLAFWGAVGSIEAIGRVHDHSYGEYRALLVG
3bruB           RLLDQAFLDGSLAPLARLRLRAEEGARHGFRRGCLVGNLGQEGALPDDFRAALIGVRTAQLFREAQACG-
3b81A           NEVLK--ESEEGLNSIERLKKILLAGIINSPSNKIFHQKLV------AIIKYFAPIYADIISQGNEEGVF
3b6aA           ----EVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTM-NLLRSGGL----
3cdlA           V------YRPLVSLREQLLELLWGKRNLTDFLDLARVVVGATIHSPERAQVWLEETFSAWIRAAQKDGRL
2dg8C           AVFDE--HLGAAADRDEAREAVADLVHELSEDSQRDLVLTQELYTLAARQPAYRELT-HEWMRRSR----
3bjbE           P------GESPQDAVYNVLVRATRGLLRRPALSTAIQSTSTANVASVPDAGKVDRAFRQILDAAGIEHPT
3dcfA           ERFHA--IAAGPGSPGERIHALLVEHTRTILRNLDANTLFY----NLSPERERERKREREYTEIQRLYAE
3dpjF           QLADW---QGTGDSPRARIASFIDLINRAKIGCPVGSLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAE
2eh3A           SLFEE-----NKEKTPEELLEFLEVLYREK---KVVYIFLFDLLCSEKFRNIYFEKI-EDAKRRFEKFLE
3bhqA           DIIESVTTLLSEAIFEGGLQQLARRLIAVLDEELLKLRRLIANADRPQLGRAWYEKGFERLASTASCFQK
3b6cB           -EVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDEL----
3dpjE           QLADW---QGTGDSPRARIASFIDLINRAKITRYGCPVGSLLSKLDHAAQGQANGLFTLFRDWLQRQFAE
3dpjA           QLA---DWQGTGDSPRARIASFIDLINRAKITRYGCPVG-------------------------------
3colB           STTDLDRLSDSTIDVTTRIRLYVQQVYDYSLANPDIIQQIKALNPNNIVANLLTAAIDAKVIKQLPVS--
3bjbB           FKKSA---ESPQDAVYNVLVRATRGLLRRPALSTAIQSTSTANVASVPDAGKVDRAFRQILDAAGIEHPT
3btiB           QEQWKKEQIKAKTNREKF-YLYNELSLTTEYYYPLIIEFYTEYYKTNSINEKMNKLAYHVIFKEGNLNG-
3bt9B           QEQWKKEQIKAKTNREKF-YLYNELSLTTEYYYPLIIEFYTEYYKTNSINEKMNKLAYHVIFKEGNLNG-
3c07A           AAVRE--VLARETDLEARLAGVLKVWLDIATPYHEFAVQFFKNAADPDSPLSPFSPESEHARVEAGIHRA
3dcfB           ERFHA--IAAGPGSPGERIHALLVEHTRTILRNLDANTLFY----NLSPERERERKREREYTEIQRLYAE
3bjbC           --------VGFKKSADAVYNVLVRATRGLLRRPALSTAIQSTSTANVASVPDAGKV--DRAFRQILDAAG
3br0A           SEQIKAKTNREK--FYLYNELSLTTEYYY-PLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKE
3bjbF           PPGES-----PQDAVYNVLVRATRGLLRRPALSTAIQSTSTANVASVPDAGKVDRAFRQILDAAGIEHPT
3dewA           QLDDIRGQAGDPLAVTAYLRWTIQRHRN--NPQLLRFYTSELTNPTPCFAAIVSPALLAESIEAGTRGLF
3br0B           EQWKS--EQIKAKTNREKFYLYNELSLTTEYLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKE
3b6aB           -EVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDEL----
3br5E           EQWKS--EQIKCKTNREKFYLYNELSLTTQYYYPLIIEFYTEYYKTNSINEKMNKLAYHVIFKEGNLNG-
3dpjB           QLAD---WQGTGDSPRARIASFIDLINRAKITRYGCPVGSLC----------------------------
3c07B           AAVRE--VLARETDLEARLAGVLKVWLDIATPYHEFAVQFFKNAADPDSESEHARVEAIGIHRAVLAGAK
3br6A           K-----SEQIKAKTNREKFYLYNELSLTTEYPLQNAIIEFYTEYYTNSINEKMNKLAYHVIFKEGNLNG-
3br5D           EQWKS--EQIKCKTNREKFYLYNELSLTTQYYYPLQIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKE
3br3A           KSEQI----KAKTNREKF-YLYNELSLTTQYYYPLIIEFYTEYYKTNSINEKMNKLAYHVIFKEGNLNG-
3cdlB           LVSLREQLL------ELLWGKRNLTDSS--FLDLARVVVGATIHSPERAQVWLARINEETFSAWIRAAKD
3crjA           DSIHD-----------------------------------------------------------------
3bjbA           PQD-------------------------------------------------------------------
3br2A           K----KEQIKAKTNREKF-YLYNELSLTTEYYYPLQIEFYTEYYKTNSINEKMNKLAYHVIFKEGNLNG-
3bqzA           K----KEQIKAKTNREKF-YLYNELSLTTQYYYPLQIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKE
3crjD           DSIHD-----------------------------------------------------------------
3crjB           DSIHD-----------------------------------------------------------------
3br5A           EQWKS--EQIKCKTNREKFYLYNELSLTTQYYYPLIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKE
2dtzD           K----KEQIKAKTNREKF-YLYNELSLTTEYYYPLIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKE
3br2E           K----KEQIKAKTNREKF-YLYNELSLTTEYYYPLIIEFYTEYYKTNSINEKMNKLQ-NKYIDAYHVIGN
3br3B           EQWKS--EQIKAKTNREKFYLYNELSLTTQYYYPLIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKE
3br2D           K----KEQIKAKTNREKF-YLYNELSLTTEYYYPLIIEFYTEYYKTNSINEKMNKLQ-NKYIDAYHVIGN
2dtzB           K----KEQIKAKTNREKF-YLYNELSLTTEYPLQNAIIEFYTEYKTNSINEKMNKLENKYIDAYHVIFKE
2dt5A           RELRH-----------------------------------------------------------------
3br1D           K----KEQIKAKTNREKF-YLYNELSLTTQYYYPLIIEFYTEYYKTNSINEKMNKLE-NKYIDAYHVIEG
3bqzB           K----KEQIKAKTNREKF-YLYNELSLTTQYYYP-LQNAIIEFYTEYTNINEMNKLE-NKYIDAYHVIFK
2d6yA           SVPVDPDDI----------EGWIDRLLDYHAAHPELLRLLFWEGEYGTAELPHEAERQEAAVRDGQERG-
2d6yB           SVPVDPDDI----------EGWIDRLLDYHAAHPELLRLLFWEGEYGTAELPHEAERQEAAVRDGQERG-
3bqyA           ----------------------------------------------------------------------
3egqB           NPRSVEEVVDYGIGFIAERREFIEFYSQVRIEELERFGEALEKVASLFEGCRHPRETAIALALSIYSLYF
3egqA           NPRSVEEVVDYGIGFIAERREFIEFY--------------------------------------------
3br5B           KSEQI----KCKTNREKF-YLYNELSLTTQYPLQNAIIEFYTEYKTNSINEKMNKLENKYIDAYHVIFKE
3bjbD           ----------------------------------------------------------------------
3br2B           K----KEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYTNSINEKMNKLQNKYIDAYHVIFKE
3br1B           K----KEQIKAKTNREKF-YLYNELSLTTQYYYPLQNAIIEFYTEYNEKMNKLENKYIDAYHVIFEGNLN
1aerB           ----------------------------------------------------------------------
3br6B           WQEQWKSEQIKAKTNREKFYLYNELSLTTEYPLQNAIIEFYTEYYTNSINEKMNKLQNKYIDAYHVIFKE
2bjcA           ELN-------------------------------------------------------------------
1cjgA           EL--------------------------------------------------------------------
3crjC           DSIHD---VETTDPEARLNLLLDELLVKPQENPDLSVALLERSQAPYQNDEYVRYL--KAVINHGIDEG-


                         +         .         .         .         .         *         .:210
query           KMSDEIPHEYIEEYAIGSMLNLSIYWLEKDNPEPPNEFAKIMMRTRTKAxxxxxxxx
1a6iA           ISAVSHFTLGAVLEQQEHLPPLLREALQIMDSDDGEQAFLHGLE-------------
2dg7A           QVDADTA-ELVAQLATVAFGSAFRRWIDAEGHADFGSCLDTVTD-------------
1bj0A           GLYAIHFTLGAVLEQQEHLPPLLREALQIMDSDDGEQAFLHGLE-------------
1du7A           FTLGAVLEQQE-HTADENLPPLLREALQIMDSDDGEQAFLHGLE-------------
3bruA           ELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGR-------------
1bjzA           AVSHFTLGAVL-EQQEHNLPPLLREALQIMDSDDGEQAFLHGLE-------------
3c2bB           -YLRFDDAEEAYRSFYGLIVSDLHVRLLGEAPDDFSARAKKAVV-------------
3bniB           VQLAFRVAPDGDEKIIEEARELLRAYLG-----------------------------
2dg8D           VHLEKHFDPGTARQLDALIEGLTLHRALAREPHGRALTLEAIAR-------------
1bjyB           FTLGAVLEQQE-HTAALNLPPLLREALQIMDSDDGEQAFLHGLE-------------
2dg8A           VHLEKHFDPGTARQLDALIEGLTLHRALAREPHGRALTLEAIAR-------------
3b6cA           ---AAYGGDLLSTFVTAEALEQSSRVFADQLHGYLKSLPATSFPN------------
3cjdB           IFPEDDAELDLTRTLFSSVHGIVLLGLENRISGVPGEQLKTIRL-------------
3e7qA           VLRQGWADFDAELAAIALLDGLWLESGLNPATFTPRQGVQICEA-------------
3colA           KQLPVSLHGVVFSTIHTHTTNISKGRYAQDQYTF-----------------------
3c2bA           YLRFDDAEEAYRSFYGLIVSDLHVRLLGEAPDKDFSARAKKAVVA------------
2dg8B           VHLEKHFDPGTARQLDALIEGLTLHRALAREPHGRALTLEAIAR-------------
3bniA           VQLAFRVAPDGDEKIIEEARELLRAYL------------------------------
3cjdA           IFPEDDAELDLTRTLFSSVHGIVLLGLENRISGVPGEQLKTIRL-------------
3cwrA           RLPLPIPAERVADLLLSAVIAEPLRQITLGLREPLPA--------------------
3cwrB           RLPLPIPAERVADLLLSAVIAEPLRQITLGLREPLPA--------------------
3ccyA           LRPDAANRTLAHVDTLFFGINWTYTWYKADGSVSPDALAERTVQ-------------
3e7qB           VLRQGWADFDAELAAIALLDGLWLESGLNPATFTPRQGVQICEA-------------
3bruB           ELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGR-------------
3b81A           KVKYP---LETAEIILTLSHFYLDEDLFKWKKEDSLKLTAF----------------
3b6aA           ---HDELAAYGGDLLSTFVTAEALEQSSRQGREQAGVFADQLHG-------------
3cdlA           ---KPVDPGFAATQHALLKSFAFWPQVTFNAALLTPQEQSNVVE-------------
2dg8C           VHLEKHFDPGTARQLDALIEGLTLHRALAREPHGRALTLEAIAR-------------
3bjbE           E----EDLTALRLLVQLWFGVIQSCLNGRVSIPDAESDIRRACDL------------
3dcfA           GVATELLDVDPTVATLLGAAIWTYRWYDPEGRLSADEVVEQITRL------------
3dpjF           AGCTTEAPALAHLLARSQGAATLAQSFHDEGFLRSEVADHRWLD-------------
2eh3A           KHFPSKA-EILSEIILGFLRQLILHYVIKEERELPFLKEKLREGLKL----------
3bhqA           LTNRLIQTGDPYLSHLFGLLWIPNEAFTGSNRRSKAELERHA---------------
3b6cB           ---AAYGGDLLSTFVTAEALEQSSRGVADQLHGYLKSLPATSFP-------------
3dpjE           AGCTTEAPALAHLLARSQGAATLAQSFHDEGFLRSEVADHRWLDNTLPT--------
3dpjA           ---------------------------------------------------------
3colB           ---------------------------------------------------------
3bjbB           ----EEDLTALRLLVQLWFGVIQSCLNGRVSIPDAESDIRRACD-------------
3btiB           EWSINDVNAVS-KIAANAVNGIVTFTHEQNINERIKLMNKFS---------------
3bt9B           EWSINDVNAVS-KIAANAVNGIVTFTHEQNINERIKLMNKFS---------------
3c07A           VLAGAKTKVPEELPELWLSQGLVLYWIRTEGRERSYRLAERGAR-------------
3dcfB           GVATELLDVDPTVATLLGAAIWTYRWYDPEGRLSADEVVEQITRL------------
3bjbC           IEHPTEEDLTALRLLVQLWFGVIQSCLNGRVSIPDAE--------------------
3br0A           GNLNEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKFS---------------
3bjbF           EEDLTA----LRLLVQLWFGVIQSCLNGRVSIPDAESDIRRACDL------------
3dewA           RLHAVNSALALAGVNYFFLSTLATEGLTSHSPDQDEELIRQYVA-------------
3br0B           GNLNEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKF----------------
3b6aB           ---------------------------------------------------------
3br5E           EWSINDVNAVS-KIAANAVNGIVTFTHEQNINERIKLMNKFS---------------
3dpjB           ---------------------------------------------------------
3c07B           TKVPEELRDILPELWLSQGLVLYWIFDRTEGRERSYRLAERGAR-------------
3br6A           -EWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFS---------------
3br5D           GNLNEWSINDVNAKIAANAVN-GIVTFTEQNINERIKLMNKFSQI------------
3br3A           EWSINDVNAVS-KIAANAVNGIVTFTHEQNINERIKLMNKFS---------------
3cdlB           GRLKPVDPGFAATQHALLKSFAFWPQVTFNAALLTPQEQSNVVE-------------
3crjA           ---------------------------------------------------------
3bjbA           ---------------------------------------------------------
3br2A           EWSINDVNA-VSKIAANAVNGIVTFTHEQNINERIKLMNKFS---------------
3bqzA           GNLNEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKFS---------------
3crjD           ---------------------------------------------------------
3crjB           ---------------------------------------------------------
3br5A           GNLNEWSINDVNAVSANAVNGIVTFTQNINERIK-----------------------
2dtzD           GNLNEWSINDVNAVSANAVNGIVTFTQNINERIKLNKFSQIFLN-------------
3br2E           L-NGEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKFS---------------
3br3B           GNLNEWSINDVNAVSAANAVN-GIVTFTEQNINERIKLMNKFSQI------------
3br2D           L-NGEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKFS---------------
2dtzB           GNLNEWSINDVNAKIAANAVNGIVTFTHEQNINERIKLMNKFSQI------------
2dt5A           ---------------------------------------------------------
3br1D           NLNGEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKFSQI-------------
3bqzB           EGNLEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKFSQI-------------
2d6yA           VITDAIPAPDLLFLLVAANWAVVVPQKRILVGGGDAGTDGLRDS-------------
2d6yB           VITDAIPAPDLLFLLVAANWAVVVPQKRILVGGGDAGTDGLRDS-------------
3bqyA           ---------------------------------------------------------
3egqB           DLGKLEKYREIAEF-------------------------------------------
3egqA           ---------------------------------------------------------
3br5B           GNLNEWSINDVNAVSAANAVNGIVTFTHEQNINERIKLMNKFSQ-------------
3bjbD           ---------------------------------------------------------
3br2B           GNLSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFS---------------
3br1B           GEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQI-------------
1aerB           ---------------------------------------------------------
3br6B           GNLNEWSINDVNAVSANAVNGIVTFTHEQNINERIKLMNKF----------------
2bjcA           ---------------------------------------------------------
1cjgA           ---------------------------------------------------------
3crjC           VFTDVDAEHVTR--SLLTIIDGARTRAVLDDTEELETARQTASE-------------