[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00528.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1b79A.bssp"
#ERROR : Can't open dsspfile "1b79B.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3b9cA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3eizA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"

## Summary of PDB Search
:463
    4e-38  14%  3cmxA  [x.x.x] PROTEIN RECA
    3e-34  47%  1b79A  [a.81.1] DNAB HELICASE
    3e-32  47%  1b79B  [a.81.1] DNAB HELICASE
    2e-31  12%  3cmtD  [x.x.x] PROTEIN RECA
    3e-25  14%  3cmwC  [x.x.x] PROTEIN RECA
    4e-24  12%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    1e-23  17%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    2e-23  32%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-23  11%  3cmuA  [x.x.x] PROTEIN RECA
    6e-22  11%  3b9cA  [x.x.x] HSPC159
    7e-20  15%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    2e-19  13%  3cmwA  [x.x.x] PROTEIN RECA
    2e-17  14%  3cmvA  [x.x.x] PROTEIN RECA
    2e-17  17%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    9e-16  12%  3cmvH  [x.x.x] PROTEIN RECA
    3e-13  31%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-10  18%  1e0jA  [c.37.1] DNA HELICASE
    3e-09  19%  3cmvE  [x.x.x] PROTEIN RECA
    5e-08  17%  1e0jB  [c.37.1] DNA HELICASE
    3e-06  15%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    4e-06  12%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    6e-06  15%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    3e-05  23%  3eizA  [x.x.x] INORGANIC PYROPHOSPHATASE
    5e-05  64%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    9e-05  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
:463

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxPPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT
3cmxA           ----------------------------------------------------------------------
1b79A           ----------PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
1b79B           ----------PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
3cmtD           -------------------------------------------AVKEGENVVGSETRVKVVKNKIAAPFK
3cmwC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3bgwA           -------------NEYAEQAVLGSILTEPELIKECPLT--PEHFSPGKHFNIYFTMQDLDRKGQSVDFTS
3cmuA           -----------------------------------LDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQ
3b9cA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dvlC           ----------------------------------------------------------------------
3cmvH           ----------------LKQSNTLLIFINQG---------GNALKFYASVRLDIRRIGAVKEGENVVGSET
3bgwD           -------------NEYAEQAVLGSILTEPELIKECPL--TPEHFSPGKHFNIYFTMQDLDRKGQSVDFTS
1e0jA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3eizA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSL
3cmxA           ----------------------------------------------------------------------
1b79A           LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRE----------------------------
1b79B           LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRER---------------------------
3cmtD           QAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVREL
3cmwC           ----------------------------------YSYKGEKIGQGKANATAWLKDNPETAKEIEKKVREL
3bs4A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3bgwA           IAARVG--EKLPQLGGFGYLTELAASVASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVNVKPIQEAVS
3cmuA           AEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELL
3b9cA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dvlC           ----------------------------------------------------------------------
3cmvH           RVKVVKNKIAAPFKQAELYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPET
3bgwD           IAARVGEKLPQL-------------------------GGFGYLTELAASVASTTTFKQHCQTVSEYFQKR
1e0jA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkeA           ------------------------------------------IKTINDLPGISQTVINKLIEAGSSLETL
2cvfA           ----------------------------------------------------------------------
3eizA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dflA           ---------------------------------------------INDLPGISQTVINKLEAGYSSLETL


                         +         .         .         .         .         *         .:210
query           LDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILA
3cmxA           ------SAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIAAGGLPMGRIVEIY
1b79A           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
3cmtD           LLSNPNSAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIAAGGLPMGRIVEIY
3cmwC           LLSNPNSAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIAAGGLPMGRIVEIY
3bs4A           ----------------------------------------------LSWEIEELDREIGKKKHSLILIHE
1cr1A           --------------------------------RIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVT
3bgwA           ELMEIEASGTDDDDGSIDEALVTVYEEIE---------SADGNITGVPSGFTELDRMTYGYKRRNFVLIA
3cmuA           LSNPN-SAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGGLPMGRIVEIY
3b9cA           ------------------------------------------------------GHIKGGMRPGKKVLVM
3dvlD           ---------------------------------------EHQAIAKMRTMIEGFDDISHGLPIGRSTLVS
3cmwA           -------------------------------------------VETISTGSLSLDIAAGGLPMGRIVEIY
3cmvA           ----------------------GQIEKQFGKGSIMRLGEDRMDVETISTGSLSLDIALGGLPMGRIVEIY
3dvlC           ---------------------------------------EHQAIAKMRTMIEGFDDISHGLPIGRSTLVS
3cmvH           AKEIEKKVRELLLKQKALAAALGQIEKQFGKGSIMRLGEDRMDVETISTGSLSLDIAAGGLPMGRIVEIY
3bgwD           KAISIAQQIIENVNVKPIQEAVSELMEIEIDEALVTVYEEIESADGNITGVPSLDRMTYGYKRRNFVLIA
1e0jA           ----------------------IPDGVVSALSLRERIRELSSSVGLLFSGCTGINDKTLGARGGEVIMVT
3cmvE           ----------------------GQIEKQFGKGSIMRLGEDRMDVETISTGSLSLDIAAGGLPMGRIVEIY
1e0jB           ----------------------------SLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVT
1cr4A           --------------------------------RIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVT
2bkeA           AVASPQDLSVAAGIPLSTAQKIIKEARDALDIRFKTALEKERNVKKISTGSQALDGLLAGGIETRTTEFF
2cvfA           ----------------------------------------------LSTGTKSLDSLGGGFAPGVLTQVY
3eizA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dflA           AVASPQDLAGIPLSTAQKIIKEARDALDIRFKTALEVKKERMNVKKISTGSQADGLLAGGIETRTMTEFF


                         .         .         .         +         .         .         .:280
query           ARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVA
3cmxA           GPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARK-LGVD----------------IDNLLCS
1b79A           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
3cmtD           GPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKL-GVDIDNLLCSQ---------------
3cmwC           GPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARKL-GVDIDNLLCSQ---------------
3bs4A           EDASSRGKDILFYILSRKL-KSDNLVGMFSISYPLQLIIRILS-RFGVDVIKYLENHRLAIVDTFGSFHG
1cr1A           SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQW
3bgwA           ARPS-MGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLS
3cmuA           GPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQ----------------
3b9cA           GIVDLNPESFAISLTCGDSEDPPADVAILKAVFTDRQLLRNSCISGEREEQSAIPYFPFIPDQPFRVEIL
3dvlD           GTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVD---------EGKLFIL
3cmwA           GPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQ----------------
3cmvA           GPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP---------------
3dvlC           GTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNAR-SFGWDLAKLVDEGKL------FILDA
3cmvH           GPESSGKTTLTLQVIAAAQRE------------------------GKTCAFIDAEHALDPIYARKLGVDI
3bgwD           ARPSMGKTAFALKQ-AKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLS
1e0jA           SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQW
3cmvE           GPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKL----GVDIDNLLCSQPDTGEQALEICD
1e0jB           SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQW
1cr4A           SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQW
2bkeA           GEFGSGKT--------------------------------------------------------------
2cvfA           GPYASGKTTLALQTGLL----SGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPS------
3eizA           --------------------------------------------------------------------LE
3bh0A           ----------------------------------------------------------------------
2dflA           GEFGSGKTQL------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA
3cmxA           Q------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHGLAARMMSQAMRKLAGNL
1b79A           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
3cmtD           -------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHGLAARMMSQAMRKLAGNL
3cmwC           -------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHGLAARMMSQAMRKLAGNL
3bs4A           IMP-----GVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLFEGRELYGFAISMSGYLEVFTPEETLRYLE
1cr1A           FDELFDTFHLYDSFAEAETDRLLAKLAYMR-SGLGCDVIILDHISI---------RKMIDNLMTKLKGFA
3bgwA           MAIGEISNSNINIFDKAGQSVNYIWSKTRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMA
3cmuA           -------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGSHMGLAARMMSQAMRKLAGNL
3b9cA           CE-YPRFRVFVDGHQLFDFY------HRI-QTLSAIDTIKINDLQIT-----------------------
3dvlD           --DASPDPEGQEVVGGFDLSALIERINYAI-QKYRARRVSIDSVTSVF--QQYDASSVVRRELFRLVARL
3cmwA           -------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGSHMGLAARMMSQAMRKLAGNL
3cmvA           --------DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGIGDSHMGLAARMMSQAMRKLAGNL
3dvlC           SPDPEGQEVVGGFDLSALIERINY-----AIQKYRARRVSIDSVTSVF--QQYDASSVVRRELFRLVARL
3cmvH           DNLLCSQPDTGEQALEICDALARSGA---------VDVIVVDSVAALTPL----AARMMSQAMRKLAGNL
3bgwD           MAIGEISNSNDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMA
1e0jA           FDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDSIVVSASGESDERKMIDNLMTKLKGFA
3cmvE           A--------LARS--------------------GAVDVIVVDSV----AALTPLAARMMSQAMRKLAGNL
1e0jB           FDELFGNDTLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFA
1cr4A           FDELFGNDTFHLYDSFAEAETD--RLLAKLAYMRSGLGCDVIIL------DHISIRKMIDNLMTKLKGFA
2bkeA           ----------------------------------------------------------------------
2cvfA           -------DFKEQRRVIGSLKKTVDSNFALVVVDSITAH-------YRAEENRSGLIAELSRQLQVLLWIA
3eizA           AQSFSNVPAGKDLPQDFNVIEIPAQSEPVKYEDKALGLLVVDRFIGTGMRYPVNYGF----IPQTLSGDG
3bh0A           -----------------------------------------------------------------LKKMA
2dflA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLN
3cmxA           KQSNTLLIFINQIRMKIGVMFGNPETTTG---GNALKFYASVRLDIRRIGAVKEG--------------E
1b79A           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
3cmtD           KQSNTLLIFINQIRMKIGVMFGNPETTTG---GNALKFYASVRLDIRRIGAVKEGEN-------------
3cmwC           KQSNTLLIFINQIRMKIGVMFGNPE---TTTGGNALKFYASVRLDIRRIGAVKEGE--------------
3bs4A           TSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRSSLGENGI---------------
1cr1A           KSTGVVLVVICH-------------LKTDLRGSGALRQLSDTIIALERNQLVLVRILK-----------C
3bgwA           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK--------------ES
3cmuA           KQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIG-----------------------
3b9cA           ----------------------------------------------------------------------
3dvlD           KQIGATTVMTTERIEEY----------GPIARYGVEEFVSDNVVILRNVLEGER----------------
3cmwA           KQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGE-----------------
3cmvA           KQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEG----------------EN
3dvlC           KQIGATTVMTTERIEEY----------GPIARYGVEEFVSDNVVILRNVLEGERRR--------------
3cmvH           KQSNTLLIFINQGGNALKFYASVR---LDIRRIGAVKEGENVVGSETRVKVV-----KNKIAAPFKQ---
3bgwD           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK--------------ES
1e0jA           KSTGVVLVVICHLKNPDKGKAHEEGRPTDLRGSGALRQLSDTIIALERNQQGDMPNLV------------
3cmvE           KQSNTLLIFINQGGNALKFYASVR---LDIRRIGAVKEGENVVGSETRVKVV------------------
1e0jB           KSTGVVLVVICHLKNPDKGEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMP---------------
1cr4A           KSTGVVLVVICHLKDLRGG---------------ALRQLSDTIIALERNQLVLVRILKCRFT--------
2bkeA           ----------------------------------------------------------------------
2cvfA           RKHNIPVIVINQV------HFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKP------------------
3eizA           DPVDVLVITPFPLLAGSVVRARALGMLKMTDESG---VDAKLVAVPHDKVCPMTANLKSIDD--------
3bh0A           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK--------------ES
2dflA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNISYAQEPxx
3cmxA           NVVGSETRVKVVKNKIAAPFKQAEFQILYGE------------
1b79A           -------------------------------------------
1b79B           -------------------------------------------
3cmtD           -------------------------------------------
3cmwC           -------------------------------------------
3bs4A           -------------------------------------------
1cr1A           RFTGDTGIAGYMEYNKETGWLEP--------------------
3bgwA           ESKNIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL--------
3cmuA           -------------------------------------------
3b9cA           -------------------------------------------
3dvlD           ---RRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAM---
3cmwA           -------------------------------------------
3cmvA           VVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN----------
3dvlC           -------------------------------------------
3cmvH           ----AEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYK--
3bgwD           ESKNIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL--------
1e0jA           ------LVRILKCRTGDTGIAGYMEYNKETGWLEPS-------
3cmvE           -------------------------------------------
1e0jB           ---NLVLVRILKCRTGDTGIAGYMEYNKETGWLEPS-------
1cr4A           ---GDTGIAGYMEYNKETGWLEP--------------------
2bkeA           -------------------------------------------
2cvfA           -------------------------------------------
3eizA           -------------------------------------------
3bh0A           ESKNIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL--------
2dflA           -------------------------------------------