[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD98844.1

[Show Plain Result]


## Summary of Sequence Search
    1::288
    2::249     2e-23  32%  267 aa  PF06800 Sugar_transport "Sugar transport protein"
    1::288

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAFMAGACWTI
PF06800         ----------------PLVSVKIGGGPYSQTLGTTFGALIFAIIVYLFTQPALTPTIIIVGLISGLFWAL


                         .         .         *         .         .         .         .:140
query           GQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXXXXXXXXDD
PF06800         GQINQFKSIK--LMGVSVTMPISTGLQLVGTSLFGVIVFGEWTTTTQIILGFIALLLIIIGVVLTSLQDK


                         +         .         .         .         .         *         .:210
query           NKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGILCGALIFVFATRETSALTARE
PF06800         EEAQAEQAKGIIILLISTIGYLVYVVIPRLF---NIDGWSAILPQAIGMVLGAVILTFFVKHKP--FNKY


                         .         .         .         +         .         .         .:280
query           SWXXXXXXXXXXXXXXXXXFSAQENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRExxxxxxxxxxxxx
PF06800         AIRNILSGLIWGIGNLFLLISAPRVGVATSFSLSQLGVVISTLGGIFILGEKKTKRE-------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxx
PF06800         --------