[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD98845.1

[Show Plain Result]


## Summary of Sequence Search
    1::448
    2::147     1e-12  29%  192 aa  PF06738 DUF1212 "Protein of unknown function (DUF1212)"
    1::448

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIMLLSYGTGAWRVRDSMNA
PF06738         --------------------------------------------------GRALLQSGAESYRVEDTMQR


                         .         .         *         .         .         .         .:140
query           IARELNISCSADVGLVSIEYTCVDEEGHGYTQALSLASTGVNTDKLSEMEQFVMDFNKGGSDLSSEQIHE
PF06738         IARALGLDVEVFVTPTAI-VLSFDDDGTCITEVRRVRDRGINLEKLTDVNRLSREVEHG--LISLEEAHK


                         +         .         .         .         .         *         .:210
query           ILDEIERKPGHYTXXXXXXXXXXXXXXFVFLLGGGLVEMLCSFVGAGFGNYIRRKMIERRxxxxxxxxxx
PF06738         RLDEIKPEKPPYPRWLVVLAAALACAGFALLFGGGWIDLLIAFLAGALG-YLVRLLLARR----------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06738         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06738         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06738         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06738         ----------------------------