[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD98850.1

[Show Plain Result]


## Summary of Sequence Search
    1::380
    5::383     1e-97  52%  384 aa  PF01053 Cys_Met_Meta_PP "Cys/Met metabolism PLP-dependent enzyme"
    1::380

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIADLEGGVXXXX
PF01053         -------VHAGYEPD-TTGAVAPPIYQTSTFHAAALGEEPGYIYSRLGNPTRDALEERLAALEGGEAALA


                         .         .         *         .         .         .         .:140
query           XXXXXXXIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYF
PF01053         FASGMAAITAALALLKAGDHIVASDDLYGGTYRLFEKVLPRFGIEVTFVDPTDLEALEAAIRPNTKLVFL


                         +         .         .         .         .         *         .:210
query           ETPTNPLLQXXXXXXXXXXXXXXXXXXXVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVT
PF01053         ETPSNPLLEVVDIEAIAAIAHAHGALLVVDNTFATPYLQRPLELGADIVVHSATKYLGGHSDVLGGVVVD


                         .         .         .         +         .         .         .:280
query           SDEKIAEKLAFLQNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDF
PF01053         NGKELAERLRFLRRDLGAVLSPFDAWLLLRGLETLALRMERHSENALAVAEFLEAHPKVAKVYYPGLPSH


                         .         *         .         .         .         .         +:350
query           PGHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENG
PF01053         PGHELAKRQMKGGGGVLSFELKGGEEAKRFLDALKLFSLAVSLGGVESLIEHPASTTHAQLPPEERAAAG


                         .         .         .         .         *         .         .:420
query           IKDELIRLSVGIEDEEDLINDLKQALxxxx
PF01053         ITDGLIRLSVGLEDVDDLIADLEQAL----