[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD98930.1

[Show Plain Result]


## Summary of Sequence Search
    1::362
    1::123     5e-27  52%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTILNIIAGLSDATSGDVYFDGKRI
PF00005         ---------------------------------------------STLLRLLAGLLKPTSGKILLDGV-I


                         .         .         *         .         .         .         .:140
query           NDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGG
PF00005         SPLELRKLRIGYVFQDPALFPHLTVRENIAFGLKLKEIKKKEAKEEILEALERVGLLKFLYRYPHELSGG


                         +         .         .         .         .         *         .:210
query           QRQRVAIARAIVLDPKVLLLDEPLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         QRQRVAIARALIKEPKVLLLDEPTS---------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxx
PF00005         ------------