[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD98951.1

[Show Plain Result]


## Summary of Sequence Search
    1::214
    4::156     5e-14  37%  157 aa  PF00881 Nitroreductase "Nitroreductase family"
    1::214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTPEGKDKLRSFF
PF00881         ---------------RRSVRKFDPE-PVSDEELEEILEAARLAPSSGNLQPWRFVVVRDPELKERLAPAA


                         .         .         *         .         .         .         .:140
query           MKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILNTFLPLYENADKQLLTADAMV
PF00881         L------------------ELLAAAEADAETGN---QENLFDAPVVLVVVGKKDYYTNAYGERGYRWAQL


                         +         .         .         .         .         *         .:210
query           DSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPERYVPVMAIAVGxxxxxxxxxxxxxxxxxxx
PF00881         DAGIAAQNLLLAATALGLGSCPIGGFDTDAVRELLGL-PENETPLALIAVG-------------------


                         .         .         .         +         .         .         .:280
query           xxxx
PF00881         ----