[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99160.1

[Show Plain Result]


## Summary of Sequence Search
    1::82
    1::67      5e-18  66%   69 aa  PF01197 Ribosomal_L31 "Ribosomal protein L31"
    1::82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
PF01197         MKKGIHPEYREVVFTDTSCGNTFLTRSTKE------------YPLITVDICSKSHPFYTGKQKFVDTAGR


                         .         .         *         .         .         .         .:140
query           VDRFNKKYGxxx
PF01197         VDKFNKRYG---