[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99183.1

[Show Plain Result]


## Summary of Sequence Search
    1::181
    6::70      2e-14  56%   71 aa  PF04167 DUF402 "Protein of unknown function (DUF402)"
    1::181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxALVYFHK
PF04167         ---------------------------------------------------------------AISYFPP


                         .         .         *         .         .         .         .:140
query           HYWFNIVTMIRENGVSYYCNLASPAVLDKEALKYIDYDLDVKVFPNGEKRLLDVDExxxxxxxxxxxxxx
PF04167         GKWYNVTAMLDENGVGYYIDIASPARIDEEAVKYIDLDLDVVVYPDGEYEVLDEDE--------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04167         -----------------------------------------