[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99233.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
    4::288     6e-35  36%  295 aa  PF00294 PfkB "pfkB family carbohydrate kinase"
  105::164     5e-05  41%  245 aa  PF08543 Phos_pyr_kin "Phosphomethylpyrimidine kinase"
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDVQGEM
PF00294         ------VIGEVMIDLVPTVDR----GETVRASSFEQSPGGAGANVAVALARLGARVALVGAVGDDEFGRF
PF08543         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFE
PF00294         LLDELEAEGVDTSGV-RVDPGTGVALILVDGDGERTIVIYRGANADLTPEELADAGADILHLSGLLPEEE
PF08543         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLI
PF00294         ATLEAAIEAAKAGGDPNLRDPLW-ADAREALRELLPYVDILKPNEEEAEALTGAEGEDPEEALAALRKLL
PF08543         --------------------------APDAVEALREELDLITPNLFEAELLTGIKITSLEDLKEAARALH


                         .         .         .         +         .         .         .:280
query           DQGINNVIITLGKQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKA
PF00294         EKGVKIVVVTLGADGALLYTGDGEYHVPAVPPVEVVDTTGAGDAFVAGLLAGL-LAGKSLEEALRFANAA
PF08543         ALGPKAVLVKGG----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SSLAVQRLGAxxxxxxxxxxxxxxxxx
PF00294         AALVVTRPGA-----------------
PF08543         ---------------------------