[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99245.1

[Show Plain Result]


## Summary of Sequence Search
    1::194
    1::85      4e-26  59%   86 aa  PF06265 DUF1027 "Protein of unknown function (DUF1027)"
    1::194

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIKIDGRPYDLVENYHEGFSAERLGERFSQILTKYDY
PF06265         ----------------------------------VKINGHQYELIENYRDAFDEEAFKERYSEILDKYDY


                         .         .         *         .         .         .         .:140
query           IVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCNFGCSYFILxxxxxxxxxxxxxxxxxxxxx
PF06265         IVGDWGYEQLRLKGFYDDDNQKATKDTKISTLQDYLYEYCNFGCAYFVL---------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06265         ------------------------------------------------------