[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99261.1

[Show Plain Result]


## Summary of Sequence Search
    1::326
    2::89      5e-22  52%   90 aa  PF08541 ACP_syn_III_C "3-Oxoacyl-[acyl-carrier-protein (ACP)]
    1::66      4e-19  52%   79 aa  PF08545 ACP_syn_III "3-Oxoacyl-[acyl-carrier-protein (ACP)]
    1::326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08541         ----------------------------------------------------------------------
PF08545         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE
PF08541         ----------------------------------------------------------------------
PF08545         -----------------------------------FDVNAACSGFLYALSTAAALIRSGQAKRALVVGAE


                         +         .         .         .         .         *         .:210
query           NLSKLIDWNDRSTAVLFGDGAAGALIELKEDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08541         ----------------------------------------------------------------------
PF08545         TLSRIVDWTDRSTCVLFGDGAGAVVLEASEE---------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDS
PF08541         ---------------------------EKAGLTPDDIDWFVPHQANRRIIDAIAKRLGLPEEKVVMNLDR
PF08545         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKx
PF08541         YGNTSAASIPLALDEALESGRLKPGDRVLLAGFGAGLTWGAAVLR-
PF08545         ----------------------------------------------