[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99303.1

[Show Plain Result]


## Summary of Sequence Search
    1::649
    1::151     2e-20  34%  170 aa  PF00587 tRNA-synt_2b "tRNA synthetase class II core domain (G, H,
    2::78      1e-15  45%   91 aa  PF03129 HGTP_anticodon "Anticodon binding domain"
    1::60      2e-12  52%   60 aa  PF02824 TGS "TGS domain"
    1::649

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITxxxxxxx
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ---IRVTTPDGSVKELPKGSTPLDFAYSIHKSLAKAFVAAKVNGQLVDLSHPLEDDDVVEIVT-------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIRRVI
PF00587         -----------------------------------------------------------------IKRAL
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ERYIIDKEVAWGFQHVYTPVLANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELRPMNCPSHIQVYNHHK
PF00587         EQFWREEFVEYGYEEIDTPILEPYELLKASGHVDKFADEMYKFKDRG-GRDLYLRPETTQPIARNFKNLL
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEPDHIEDEIKTLIKLMTEVYNDFDITD
PF00587         LSYRKLPLRLAQIGKVFRNE-IRPRRGLGRVREFTQVEAEIFGTPEQSNEELAEMIALAEEFLEKLGLDP
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YRFRLSYRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00587         YRVRLHTR--------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDIIPVKNDL
PF00587         ----------------------------------------------------------------------
PF03129         ------------------------------------------------------------VVVIPLGDEL
PF02824         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           HMDYVNDLSSKLRAHGIRVTVDDRNEKMGYKIRQAQVNKIPYTLVIGDEEVSNGTVTVRKYGEEKTxxxx
PF00587         ----------------------------------------------------------------------
PF03129         -LDYAQELAAELRAAGIRVELDDSSGSLGKKIKRADLRGIPYAIIVGEKELEDGTVTVRDTGEQET----
PF02824         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxx
PF00587         -------------------
PF03129         -------------------
PF02824         -------------------