[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99339.1

[Show Plain Result]


## Summary of Sequence Search
    1::185
    3::58      4e-18  75%   58 aa  PF08207 EFP_N "Elongation factor P (EF-P) KOW-like domain"
    1::56      1e-15  66%   56 aa  PF09285 Elong-fact-P_C "Elongation factor P, C-terminal"
    1::50      2e-13  58%   55 aa  PF01132 EFP "Elongation factor P (EF-P) OB domain"
    1::185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKVxxxxxxRKKM
PF08207         ----NDLKKGLVIEIDGEPYRVVEFEHVKPGKGGAFVRTKLKNLLTGKVVEKTFRSGEKV----------
PF09285         ----------------------------------------------------------------------
PF01132         ------------------------------------------------------------------RREM


                         .         .         *         .         .         .         .:140
query           QYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFxxxxxxxxxxxxVDLEVKETEPGI
PF08207         ----------------------------------------------------------------------
PF09285         ----------------------------------------------------------VELEVVETEPGV
PF01132         QYLYKDGDEYVFMDNETYEQIELPADQIGDALKFLKEGMEVTVLFY------------------------


                         +         .         .         .         .         *         .:210
query           KGDTSSGGSKPATMETGLVVQVPFFVSEGDVLTINTSDGTYISRx
PF08207         ---------------------------------------------
PF09285         KGDTASGGTKPATLETGAVVQVPLFINEGDKIKVDTRTGEYVSR-
PF01132         ---------------------------------------------