[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99372.1

[Show Plain Result]


## Summary of Sequence Search
    1::260
    1::221     5e-65  52%  222 aa  PF01255 Prenyltransf "Putative undecaprenyl diphosphate synthase"
    1::260

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxIMDGNGRWAKKRHLPRIAGHKQGMETVKNITKVASNLGVKV
PF01255         -----------------------------IMDGNRRWAKKRGLPRVEGHRAGFEALARILEWCYELGVKV


                         .         .         *         .         .         .         .:140
query           LTLYAFSTENWKRPDKEVDFLMDLPVKFFNTFVPELIENNVRVNVMGYIDMLPKKTQKAVYDAIEQTSNC
PF01255         VTVYAFSTENFKRPKEEVDALMDLAEEKLEQLAQELDDYGIRVRVIGDLDLLPPDVREAIERAEELTANN


                         +         .         .         .         .         *         .:210
query           TGMVLNFALNYGGRAELVSAIQSIASKVSENKLEIEKITEKVVDANLMTGKLAPYNDPDLLIRTSGEERI
PF01255         TGLVLNIAVNYGSRDEITDAVRKLAEEVAAGKLSPEDITEETLEKHLYTAGLP---DPDLLIRTSGEQRL


                         .         .         .         +         .         .         .:280
query           SNFLLWQLAYSEFVFTDTLWPDYSEEDLLANIYTFQTRDRRFGxxxxxxx
PF01255         SNFLLWQIAYSELYFLDVLWPDFDLWDFLRALLDYQRRERRFG-------