[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99438.1

[Show Plain Result]


## Summary of Sequence Search
    1::112
    1::90      2e-20  64%  100 aa  PF04297 UPF0122 "Putative helix-turn-helix protein, YlxM / p13
    1::112

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKL
PF04297         --LEKTLRMNLLFDFYGSLLTEKQREYLELYYLDDLSLGEIAEEFGVSRQAVYDNIKRTEKILEEYEEKL


                         .         .         *         .         .         .         .:140
query           HLYRNFQLQSEELDNLLKYVEExxxxxxxxxxxxxxxxxxxx
PF04297         HLLQKFQERKELLDKIKQLLSE--------------------