[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99450.1

[Show Plain Result]


## Summary of Sequence Search
    1::565
    6::143     1e-09  30%  171 aa  PF00753 Lactamase_B "Metallo-beta-lactamase superfamily"
    4::41      3e-09  58%   42 aa  PF07521 RMMBL "RNA-metabolising metallo-beta-lactamase"
    1::565

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSRKIVGVFLTHG
PF00753         -----------------NSYLIETGGGAILIDTGEGTPEQLLL--------LALLGLDPKKIDAILITHG
PF07521         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDESTEIDFENATISFFQTTHSI
PF00753         HADHIGGLPYLLEALPVPVVAHPLTAALLLELLLEDALLLPPELIVVVLEDGDGIGGGVVVLFVPAGHGH
PF07521         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PESLGVVIKTENGNVVYTGDFKFDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00753         GPG-SIVLELPGGKVLFTGDTLFD----------------------------------------------
PF07521         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxVKAIFDELNSSGHASKNDLQLMMNLVKPRYVIPVQGEYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00753         ----------------------------------------------------------------------
PF07521         --VKAQVETIHFSGHADQEELLLMLNLVKPKHVIPVHGEY------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxx
PF00753         -----
PF07521         -----