[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99526.1

[Show Plain Result]


## Summary of Sequence Search
    1::75
    2::45      1e-09  66%   46 aa  PF06855 DUF1250 "Protein of unknown function (DUF1250)"
    1::75

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKY
PF06855         --------------------------AENAFDDLSFPKQSTDYDEISSYLESNGSYLESMEIFDRAWSLY


                         .         .         *         .         .         .         .:140
query           xxxxx
PF06855         -----