[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99654.1

[Show Plain Result]


## Summary of Sequence Search
    1::429
  218::318     7e-06  28%  491 aa  PF05667 DUF812 "Protein of unknown function (DUF812)"
  634::768     7e-04  26% 1179 aa  PF12128 DUF3584 "Protein of unknown function (DUF3584)"
    1::429

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05667         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05667         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05667         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQAKEDLD
PF05667         --------------------------------------------------------------AEEEDEEE
PF12128         ---------------------------------------------------------------QARDDLK


                         .         *         .         .         .         .         +:350
query           KVQAKLAKDQKNEQKAKENIAKLEADIKTKQADYDKAKQEISTKQEALKKSQTELAEQKKVKAHAKKVLD
PF05667         EREKELQELQEQLQELRSQIEELEAEIKSLAVSIKQLEEELEAKKAEIEELESEL----KLKKRTVDLLP
PF12128         RLKNELEELKKKAEEAKERKQELEEQLNALEAELKQLKEELEELLEEQKEQLNELRNEKKAQWQELEGEL


                         .         .         .         .         *         .         .:420
query           KANKELIKVQATVQDKQAKLKELQDQFGNYVGDDDELADTKKSLTEAQTKLxxxxxxxxxxxxxxxxxxx
PF05667         DAENNLAKLQALVEASEQRLEELQQQW-------------------------------------------
PF12128         DNQLEQIKIEAERQEAKERLKELEQAYKNELADTERIQKLKQEIAQLEKEL-------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxx
PF05667         ---------
PF12128         ---------