[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99672.1

[Show Plain Result]


## Summary of Sequence Search
    1::375
   17::348     e-124  64%  348 aa  PF03054 tRNA_Me_trans "tRNA methyl transferase"
    1::375

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPY
PF03054         ----------------------AALLKEQGYDVIGVFMKNWDDDDEKGGCCAEEDLADARAVADKLGIPL


                         .         .         *         .         .         .         .:140
query           YSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMSIDADYIAMGHYAQLRRDEDGRV
PF03054         YVVDFEKEYWDRVFEYFLDEYKAGRTPNPDVLCNREIKFGALLEYARELGADYIATGHYARVRED-DGRY


                         +         .         .         .         .         *         .:210
query           HLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLATAKKKDSTGICFIGERNFSKF
PF03054         RLLRGLDPNKDQSYFLSQLSQEQLSRTLFPLGELTKPEVREIAAEAGLPTAKKKDSQGICFIGERDFRDF


                         .         .         .         +         .         .         .:280
query           LGEFLPAQPGEMVTLDGEVKGNHFGLMNYTIGQRKGLGIGGDGKSNEPWFVIGKDLKTNTLLVGQGYHNE
PF03054         LSRYLPAQPGDIVDVDGKVLGEHKGLMYYTIGQRKGLGIGGAG---EPWYVVGKDPETNTVYVGQ---HP


                         .         *         .         .         .         .         +:350
query           HLYANSLDASKLSFVDDISDCGDEFHCTAKFRYRQKDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVF
PF03054         ALYSDELIASDLNWVSGEPPEGEPFECTAKIRYRQPPVPCTVPLDDGRLRVE--FDEPQRAVTPGQAAVF


                         .         .         .         .         *         .         .:420
query           YDGEECLGSGTIxxxxxxxxxxxxx
PF03054         YDGDVCLGGGII-------------