[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99739.1

[Show Plain Result]


## Summary of Sequence Search
    1::578
  225::271     8e-07  43%  271 aa  PF01979 Amidohydro_1 "Amidohydrolase family"
  340::378     2e-06  46%  378 aa  PF07969 Amidohydro_3 "Amidohydrolase family"
    1::578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxIRICIDEGLNPITAIQMATLNPAEYCGLNDRGAIAPGRRADMVVFExxxxxxxxxxxxxxxxx
PF01979         -------LRLAVLLGLSLEEALRAATINPARALGLDDRGSLEPGKDADLVVLD-----------------
PF07969         ------------EERLSLEEALRAVTINPARALGLEDRGSLEVGKRADLVV-------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxx
PF01979         ------------------
PF07969         ------------------