[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99766.1

[Show Plain Result]


## Summary of Sequence Search
    1::102
    1::96      4e-19  60%   96 aa  PF00829 Ribosomal_L21p "Ribosomal prokaryotic L21 protein"
    1::102

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAXX
PF00829         MYAIIKTGGKQYKVEEGDVIKVEKLDAEVGDKVEFDKVLLVGGDFTKIGAPLVEGAKVKATVVEHGKGKK


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXHQHTKQGHRQPYTKVxxxxxxx
PF00829         VIIFKKKRRKGYRRKQGHRQPYTRV-------