[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99824.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
   15::236     5e-09  28%  236 aa  PF00563 EAL "EAL domain"
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxLAFQPIVRIVNEDTFEISDYEVLLRSKDKKSFPAAIFEKIVNNESCNQMFWEWFTLE
PF00563         -------------LYYQPIVDL---RTGRIVGYEALLRWRHPEGIPLAELDRWVLEEACRQLA-EWRA--


                         .         .         *         .         .         .         .:140
query           IKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGY
PF00563         -----QGPDLRLSVNLSPRQLLDP---DFVERLLELPERLVLEITESALIEDDAE--LLALLRRLRALGV


                         +         .         .         .         .         *         .:210
query           RVALDDISSGQYSFKVVQENIKGIDRVKLSLLIFNDDSTDSKTKNFFIMSWINFAKTNNVELVIEGIEDD
PF00563         RIALDDFGTGYSSLSYLKR--LPVDILKIDRSFVRDIDTDPEDR-AIVRAIIALAHSLGLKVIAEGVETE


                         .         .         .         +         .         .         .:280
query           VAAKEMLCHNIKLQQGFFWQVPxxxxxxxxxxxxxxxx
PF00563         EQLELLRELGCDLFQGYLFSKP----------------