[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99837.1

[Show Plain Result]


## Summary of Sequence Search
    1::586
    1::122     1e-11  40%  123 aa  PF00005 ABC_tran "ABC transporter"
  456::526     1e-04  36%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"
    1::586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTLANLIRGDRVATEGAITINGIDVSKVGDQI
PF00005         --------------------------------------STLLRLLAGLLKPTSGKILLDGVELRKLR---
PF02463         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER
PF00005         ---IGYVFQDPALFHLTVRENIAFGKKKEAKEEILEALERVGLLKFLYRYPHEL-----------SGGQR
PF02463         -----------------------------------------------------------------SGGEK


                         *         .         .         .         .         +         .:560
query           HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVxxxxxxxx
PF00005         QRVAIARALIKEPKVLLLDEPT------------------------------------------------
PF02463         SLTALALLFYKPAPFYVLDEVDAALDDANVQRVADLLKELSKNSQFIVITHRPGTMELADRL--------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         --------------------------
PF02463         --------------------------