[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99890.1

[Show Plain Result]


## Summary of Sequence Search
    1::183
    3::175     1e-61  58%  179 aa  PF03352 Adenine_glyco "Methyladenine glycosylase"
    1::183

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxGADQLMIDYHDKEWGRPLHDERGLFELLCLEGLQAGLSWKIVLNKRKFLREAFDNFEVEKISQ
PF03352         -------GSDPLYIAYHDEEWGVPVHDDRRLFELLCLEGFQAGLSWITILKKREAFREAFDGFDPEKVAA


                         .         .         *         .         .         .         .:140
query           YTLDDVEKLLTDPRIIRNRRKIEAIINNAKIVNALHERNESLDSFFWGIINNQPIINNFKNPEEIPTKTK
PF03352         MTEEDVERLLQDPGIIRNRLKIEAVINNARAILELQEEFGSFSAYLWSFVDGKPIVNRWASLAEVPAKTP


                         +         .         .         .         .         *         .:210
query           LSEQISKTLKKMGFKFVGPTIVYSFMEASGMVNDHLVGCYxxx
PF03352         LSDALSKDLKKRGFKFVGPTTVYAFMQAVGLVNDHLVGCF---