[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABD99944.1

[Show Plain Result]


## Summary of Sequence Search
    1::170
    4::143     4e-04  28%  143 aa  PF00588 SpoU_methylase "SpoU rRNA Methylase family"
    1::170

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITYHPNLPAFLET
PF00588         ----LVLDNPQDPGNLGAIIRTAAAFGVDVVLVKPRCADPLDPKALRASAGAHEHLPVIRVDDLEEALAD


                         .         .         *         .         .         .         .:140
query           IPENGELYIVSKFASKAYTEADYTNTEKEHYFLFGKETTGLPEMFMRQNPEKCIRIPQNDEHIRALNLSN
PF00588         LKEAGFRVVATDLGARPLYEVDLPGPVA---LVFGNEGTGLSEEVL-ELCDYLVRIPMAG-GVDSLNVSV


                         +         .         .         .         .         *         .:210
query           TAAIVVYxxxxxxxxxxxxxxxxxxxxxxx
PF00588         AAAILLY-----------------------