[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00050.1

[Show Plain Result]


## Summary of Sequence Search
    1::50
    3::48      7e-07  62%   48 aa  PF00471 Ribosomal_L33 "Ribosomal protein L33"
    1::50

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK
PF00471         -----KITLECTECGGRRYTTTKNKRNTERLELKKFCPYCRKHTLHKEIK