[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00071.1

[Show Plain Result]


## Summary of Sequence Search
    1::264
    1::85      5e-10  42%   96 aa  PF03807 F420_oxidored "NADP oxidoreductase coenzyme
    1::264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKP
PF03807         -KIGFIGAGNMGEALASGLLKAGVPPSQIIVASSRSEKAAALAEEYGVTVTADNAEAVKEADVVVLAVKP


                         .         .         *         .         .         .         .:140
query           IVVEKVLKEVKDSVLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03807         QDLEEVLAELKAELL-------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03807         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03807         ------------------------------------------------------