[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00097.1

[Show Plain Result]


## Summary of Sequence Search
    1::807
    4::51      e-120  55%  455 aa  PF00343 Phosphorylase "Carbohydrate phosphorylase"
  153::254     3e-05  36%  517 aa  PF02990 EMP70 "Endomembrane protein 70"
  252::345     9e-04  26%  476 aa  PF09481 CRISPR_Cse1 "CRISPR-associated protein Cse1 (CRISPR_cse1)"
    1::807

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxRLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEF
PF00343         ----------------------------------------------------------------------
PF02990         ---------------------------SPQELDEGKETEIPFTYSVYWRESWDKYLDNFDPQIHWFSINS
PF09481         --------------RLDE----DPEGGNVRGVVLVAGDRTKNYGANYWREPMTPYRKPKKKEGEYYPLKH


                         .         .         *         .         .         .         .:140
query           LPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI
PF00343         ------------------------------------------GNGGLGRLAACFLDSLATLGLPAWGYGI
PF02990         LVIVLFLSGLVAMILLRTLRDIARYNELDSEEDAQEESGWKLVHGDVFR---------------------
PF09481         QPGRALWRDLDALLATESADNSREYPPAVVDWLAALSEDGAL----------------------------


                         +         .         .         .         .         *         .:210
query           RYRYGLFKQKFIDGYQIELPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00343         RYEYGLFKQKIVDGYQVEVP--------------------------------------------------
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00343         ----------------------------------------------------------------------
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIM
PF00343         ---------------LDELPDKVAIQLNDTHPALAIPELMRILVDEEGLSWDEAWEITRKTFAYTNHTPL
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGV
PF00343         PEALEKWPVDLFEKLLPRHLEIIYEINRRFLDEVRAKYPEDRLRRMSIIEEGRVRMAVLALVGSHSVNGV
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ
PF00343         SALHGEVLKEMLFKDFYELWPEKFTNVTNGVTPRRWLAQANPELAALIDEYLGDDWLTDLDQLEKLEKFA
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKV
PF00343         DDEEFQEELREVKLENKQRLAEYIKERTGVELDPDALFDGQAKRFHEYKRQLLNILHIIDRYNRIKNNP-
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISE
PF00343         NKDFRPRQFIFAGKAHPGYYMAKEIIKLINEVADVVNNDPEVGDRLKVVFLENYNVSLAEKLIPGADVSE
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           QISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVxxxxxxxxxxxxxxxx
PF00343         NISTAPLEASGTSNMKFALNGALNLGTLDGANVEIAEEVGEENIFIFGLTAEEV----------------
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00343         ----------------------------------------------------------------------
PF02990         ----------------------------------------------------------------------
PF09481         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00343         -------------------------------------
PF02990         -------------------------------------
PF09481         -------------------------------------