[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00173.1

[Show Plain Result]


## Summary of Sequence Search
    1::195
    2::99      4e-06  44%   99 aa  PF04307 DUF457 "Predicted membrane-bound metal-dependent hydrolase
    1::195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGSLLPDIDHPSSYLGKRHKMVSGVTNKAFGHRGITH
PF04307         ----------------------------------GALLPDLDHPASTIGRRFGLARGLLG---GHRGFTH


                         .         .         *         .         .         .         .:140
query           SLLGFILIGIIVKFIQKQYLTDRIENIVFWLMLGYLLHLLEDSFSQRGVKWLYPxxxxxxxxxxxxxxxx
PF04307         SLLFALLLALLASLA-----AALLAALLFALLLGYLSHLLLDMLTPSGVPLLWP----------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04307         -------------------------------------------------------