[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00183.1

[Show Plain Result]


## Summary of Sequence Search
    1::618
   56::316     4e-14  27%  379 aa  PF00999 Na_H_Exchanger "Sodium/hydrogen exchanger family"
   26::97      0.001  39%  360 aa  PF03977 OAD_beta "subunit"
    1::618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGVILLMFLSG
PF00999         -----------------------------------------------------------LGLPPLLFLAG
PF03977         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MEIDFSLFKKNSHTLSPLEAKMAANEPKTSPVRAATYAYAFSLVASLILALLFKVTGLFSDVGLATILFS
PF00999         LELDLKELKRNGKSILLL---------------ALLGVLLTALLIGLLLYLLLLGLPLLAALLLGAILSA
PF03977         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TVSLGIMTSLLKENELLSRPFGQTILLFSVLGEVIPMIALTAYSSIYAGKGASLWLITXXXXXXXXXXXX
PF00999         TDPVAVL-AILKEEGLLPTRLGTLLLGESLLNDAVAIVLLALLLALASGAGGAFSLGSLLLLFLFVALGG
PF03977         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXDKINKATTQIDMRLAFFVIIALVLVAETVGAENILGAFVAGIVLKLLEPAEETEHRLDAIGY
PF00999         LLIGLLLGWLLRRDDPELEVLLALLLALLAYLLAELLGLSGILGAFLAGLVLANSEFRNELSEKLEPFWE
PF03977         -----------------------------LLLVPIGFGAANIPGAGMADTALGQLEGGGLYLFYYLGIKS


                         .         *         .         .         .         .         +:350
query           GFFTPFFFILTGVNLDIPSLMRSPKTLLLIPLFFVAFILAKLPGYFGFQRRFxxxxxxxxxxxxxxxxxx
PF00999         FLLEPLFFVLIGLSLDLSVLHLS--LWLLVLLLLLLLLLGRFLGVFLLARLF------------------
PF03977         GIFPPLIFMGVGAMTDFGPLLANPKTLLL-----------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00999         ----------------------------------------------------------------------
PF03977         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00999         ----------------------------------------------------------------------
PF03977         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00999         ----------------------------------------------------------------------
PF03977         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00999         ----------------------------------------------------------
PF03977         ----------------------------------------------------------