[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00227.1

[Show Plain Result]


## Summary of Sequence Search
    1::180
    2::94      2e-33  63%   95 aa  PF00673 Ribosomal_L5_C "ribosomal L5P family C-terminus"
    1::56      2e-13  62%   56 aa  PF00281 Ribosomal_L5 "Ribosomal protein L5"
    1::180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
PF00673         ----------------------------------------------------------------------
PF00281         ------------------------NVMQVPKLEKIVLNMGVGEA-GDDKLLENAALDLEQITGQKPVITK


                         .         .         *         .         .         .         .:140
query           AKKSIAGFRLRxxxxIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFP
PF00673         ---------------IGVKVTLRGEKMYEFLERLLTVVLPRIRDFRGLSAKSFDGRGNYSFGIKEHIDFP
PF00281         AKKSIAGFKIR-----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFxx
PF00673         EIKYDPVIGIYGMDITIVTTAKTDEEARALLKEFGMPF--
PF00281         ----------------------------------------