[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00229.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
    1::122     2e-30  60%  122 aa  PF00238 Ribosomal_L14 "Ribosomal protein L14p/L23e"
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKYGTH
PF00238         MIQKQTRLNVADNSGAKEVMCIKVLGGSKRRYAGVGDIIVVSVKKAIPKGKVKKGDVVKAVVVRTKKPVR


                         .         .         *         .         .         .         .:140
query           RPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPEVL
PF00238         RPDGSYIRFDDNAAVLINNKGEPKGTRIFGPVARELRAKKFMKIVSLAPEVL