[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00286.1

[Show Plain Result]


## Summary of Sequence Search
    1::296
    3::149     9e-22  46%  149 aa  PF00849 PseudoU_synth_2 "RNA pseudouridylate synthase"
    1::296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00849         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLV
PF00849         ----------------LVVNKPAGLVVHPGPEGR------RTVFDLLPKGRKPRLG-LVHRLDKDTSGLL


                         +         .         .         .         .         *         .:210
query           LVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVRE
PF00849         LLAKDGEAANRLMHQFPSRKVEKEYLALVHGGPKKDEGTIDAPIGPERRRRG-VVLEDGKPAVTEYRVLE


                         .         .         .         +         .         .         .:280
query           YLGDKATLVECKLHTGRTHQIRAHFSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00849         YYTGPVTLVELTLHTGRTHQIRVHLAS-------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxx
PF00849         ----------------