[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00290.1

[Show Plain Result]


## Summary of Sequence Search
    1::273
    6::205     7e-13  33%  205 aa  PF07859 Abhydrolase_3 "alpha/beta hydrolase fold"
  141::184     3e-06  45%  208 aa  PF00326 Peptidase_S9 "Prolyl oligopeptidase family"
  143::187     7e-05  38%  213 aa  PF01738 DLH "Dienelactone hydrolase family"
  210::267     3e-04  36%  274 aa  PF03583 LIP "Secretory lipase "
    1::273

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGGGYHFVSDREADPVALKLITMGYNAFVL
PF07859         -----------------------------------------GGGFVLGSKDTHDPLCRRLAALGAVVVSV
PF00326         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------
PF03583         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NYTCQVRYPVALEQLAQSVKLVRDNADEWNVREDKIIIMGMSAGGHLAASLGVKWNSNELKQMGYKSEEI
PF07859         DYRLAPEFPAALEDALAALRWLLANAAELGIDPSRIVLAGDSAGGNLALALALRLRDRGLPL--------
PF00326         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------
PF03583         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KPNGLVLSYPVITTNKDFWHQGSFEQILGKDGIEDEKALANQSLEKLVTEDVPPVFMWHTFEDKAVPMEN
PF07859         -PAGVVLIYPVLDLRTD---SPSYELADGPPGADRDDPLASPLLADL--SGLPPTLI---VVGEADPLDE
PF00326         ----------------------------------------------------PPLLIIHGEADDRVPPQE
PF01738         -----------------------------------------------------PVLILYGEKDPLIPPEA
PF03583         -----------------------------------------------------PVLIYQGTADEIVPVSD


                         .         .         .         +         .         .         .:280
query           SLLFASALRKAGVSTEYHIFPHGPHGLALANEETARVGRPEDIEPQAAQWVDxxxxxxxxxxx
PF07859         GLAYAEKLRAAGVPVELHVYPGMPHGFLL----------------------------------
PF00326         SLKLYAALRKAGVPVELLIYPGAGHG-------------------------------------
PF01738         VEALEEALRAAGVDVELHVYPGAGHGFA-----------------------------------
PF03583         TDALVAAYCAAGADVEYHRYPGGGH------FTTAVAGAPD-----ALRWLD-----------