[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00302.1

[Show Plain Result]


## Summary of Sequence Search
    1::228
    2::158     2e-27  45%  158 aa  PF00300 PGAM "Phosphoglycerate mutase family"
  181::275     1e-04  27%  287 aa  PF05971 Methyltransf_10 "Protein of unknown function (DUF890)"
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTRAIKTLHFALE
PF00300         ---LYLVRHGESEWNAEGRLQGDSDDPLTERGRQQARALGRRLAEKGLQFDAVYSSPLRRAIQTAEIILE
PF05971         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAANDRRYAD
PF00300         GLGAL--PVIVDPRLRERDFGDLEGLTKSEIAEEFPEEYEAWWRDKYDFRP-------------------
PF05971         --------------------------------------------------PPFHASAEEASAGSERKLLR


                         +         .         .         .         .         *         .:210
query           LDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVAAHGNSLRALTKYIEQISDEDIMNVEMATGQ
PF00300         ------PGGESLADVQARVRPFLEELIAEK--DGKNVLIVTHGGVLRAL---------------------
PF05971         AKPKLNFGGQNAELWCEGEVAFVKRMIEESLQFAKQVLLVSKKSNLPPLYKALKKLGAVNVKTIEMAQGQ


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxx
PF00300         ------------------
PF05971         ------------------