[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00312.1

[Show Plain Result]


## Summary of Sequence Search
    1::241
    2::132     2e-20  34%  141 aa  PF07702 UTRA "UTRA domain"
    3::64      2e-09  39%   64 aa  PF00392 GntR "Bacterial regulatory proteins, gntR family"
   74::113     5e-04  42%  140 aa  PF05732 RepL "Firmicute plasmid replication protein (RepL)"
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPx
PF07702         ----------------------------------------------------------------------
PF00392         ------EQIYEQLREAILSGELPGDRLPSERELAEELGVSRTTVREALRRLEAEGLVERRPGRGTFV---
PF05732         -----------------------------QRELAEELGISRPTVSRTIKKLEEKGIIKKKKNGVYMINP-


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEP
PF07702         ------------------------EGRKPSSKVLSFEVVPADAEVAEALGLEPGDPVYRIERLRYADGEP
PF00392         ----------------------------------------------------------------------
PF05732         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEG
PF07702         VALEESYLPAELFPGLTAEDLEGSLYALLEEEYGLPITRAEQEIEAVLATAEEAELLGIPPGSPVLVIER
PF00392         ----------------------------------------------------------------------
PF05732         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IFFLDNGTPFEFSQxxxxxxxxxxxxxxxxx
PF07702         VTYDEDGRPVEYSE-----------------
PF00392         -------------------------------
PF05732         -------------------------------