[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00338.1

[Show Plain Result]


## Summary of Sequence Search
    1::801
    1::153     3e-37  51%  153 aa  PF09168 PepX_N "X-Prolyl dipeptidyl aminopeptidase PepX,
   48::225     9e-20  37%  238 aa  PF02129 Peptidase_S15 "X-Pro dipeptidyl-peptidase (S15 family)"
    2::207     1e-08  30%  209 aa  PF08530 PepX_C "X-Pro dipeptidyl-peptidase C-terminal non-catalytic
    1::801

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFNQFAHVKVPFEQKLAELNRIAFLHAGDEDLASNHIYRLFLERAFPNFKTEAAKNHALSNLAATENAD
PF09168         MKYNQFSYIPTDFEQALKELKQIGFLL--DENSFPKDLLETFLRRFFPEAKTSAAKDYKLSNLAATAKTD
PF02129         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ILTYLNSSKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKEIHHRDDVINAWYDLLCTSTK
PF09168         LLTFLQSDQLTAEVFYNVALQLLGFEPGVDFDLTDPLAFMKKIALPVVHDIFDTENLIDAFYRLLNTRTK
PF02129         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGQNLLDILANRGYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09168         NGQTLIDQLASKGY--------------------------------------------------------
PF02129         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09168         ----------------------------------------------------------------------
PF02129         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxRGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTK
PF09168         ----------------------------------------------------------------------
PF02129         ----------------------RGYAVVRFDVRGTGESEGEPRNGGDDEVEDAAAAIDWLAGQP------
PF08530         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANKAIPAWWSNGKVAMTGKSYXXXXXXXXXXXXXXXXXXIISEAAISSWYDYYREGGLVIAPGGFPGED
PF09168         ----------------------------------------------------------------------
PF02129         ---------WDNGRVGLLGISYGGGTALAAAATRDPRLKAIVPVAPISDLYDYYRPNGAVRLPFGL---Q
PF08530         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIKCDIVMVHGLN
PF09168         ----------------------------------------------------------------------
PF02129         WDVLAEALASRPLDALD---ALKAVARYLDELLAALDREHPDYDDFWDERSYLEDLDKIKVPVLLVGGWN
PF08530         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DWNVKLKNVFNLYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKELLPDIL
PF09168         ----------------------------------------------------------------------
PF02129         D-NVK-RGALRLY---------------------------------------------------------
PF08530         -------------------------------------------------------------AAEDLPPVR


                         .         .         .         *         .         .         .:630
query           VQNNTKESTWETYSSWQSKNFTKLYLNSDSLSAQKKENQTLEFSDHLPETTFKHYQTDIANWKEEILAST
PF09168         ----------------------------------------------------------------------
PF02129         ----------------------------------------------------------------------
PF08530         VFDNDGANPWRAEDDWPGTRYTRLYLGPT------------------PGGTLSTAAPSTAGGAASFLYDP


                         .         +         .         .         .         .         *:700
query           SPKLETNRLILTSKPLKHETLLKGVAKIKLKIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGY
PF09168         ----------------------------------------------------------------------
PF02129         ----------------------------------------------------------------------
PF08530         APPLDQDQLTFTTAPLTEDLELTGAPKLRLRVSSDGPDADLFVKLVDVGP----DGTATL----------


                         .         .         .         .         +         .         .:770
query           HWKEDNLVEFKLAKETPFKMITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIY
PF09168         ----------------------------------------------------------------------
PF02129         ----------------------------------------------------------------------
PF08530         --------------------ITRGWLRLSHRKSDEEPEPLTPGEPYEVTIELQPTAHTFKAGHRLRLVIS


                         .         .         *         .         .         .         .:840
query           ATDMEMTLQGNEENSYRIDTTGSYCLLPxxx
PF09168         -------------------------------
PF02129         -------------------------------
PF08530         SSDFPYTDRNPGTGTLTLDLAKSSLALP---