[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00427.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
    1::123     3e-20  51%  123 aa  PF00005 ABC_tran "ABC transporter"
   50::94      0.001  48%  199 aa  PF05272 VirE "Virulence-associated protein E"
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYFDDLELDFKKG
PF00005         ----------------------------------------STLLRLLAGLLKPTSGKILLDGV-------
PF05272         ------------------------KNDTVLILVGPQGTGKSTFFRLLG----PEL-EYFSDSLDLDDKDA


                         .         .         *         .         .         .         .:140
query           ISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRAYELLKKVGLADKADAYPQQ
PF00005         ISPLELRKLR--IGYVFQDPALFPHLTVRENIAFGLKNKLKEKKKEAKEEILEALERVGLLKFLYRYPHE
PF05272         LRK-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSGGQAQRVAIARSLAMNPRYILLDEPTSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         LSGGQRQRVAIARALIKEPKVLLLDEPTS-----------------------------------------
PF05272         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         --------------------------------------
PF05272         --------------------------------------