[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00441.1

[Show Plain Result]


## Summary of Sequence Search
    1::643
    1::230     2e-21  30%  236 aa  PF00122 E1-E2_ATPase "E1-E2 ATPase"
    1::194     1e-09  34%  195 aa  PF00702 Hydrolase "haloacid dehalogenase-like hydrolase"
  160::253     1e-04  31%  253 aa  PF08282 Hydrolase_3 "haloacid dehalogenase-like hydrolase"
    4::74      7e-04  42%   99 aa  PF06480 FtsH_ext "FtsH Extracellular"
    1::643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00122         ----------------------------------------------------------------------
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------
PF06480         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxAVMLFYRVGEIFEDLAIENSKKSITNLLDIRPEYANLELNGKLQQVKPELLN
PF00122         ------------------AIIFVVLLGALVEAYADYKAEKALRALNSLNPKTATVLRDGKEVEIPSKDLV
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------
PF06480         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTV
PF00122         VGDIVLVKPGDRVPADGVLSSGDLFVDESALTGESNPVLATKGNIVLRGTVVRSGSGLGVVTATGKDTKL
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------
PF06480         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VKILELVQNASEKKTKTENFITKFSQIYTPVIVISAIMLASIPPLFLGQEFQVWLYRALIFLVISCPCAL
PF00122         GKIARLVEEAQSKKTPLQRKLDRLAKILVPLVLALAALTFIIWLFDVGGSFLKAFLIAVALLVVAIPEGL
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------
PF06480         ----------------------------------------------------LWLLIALVLLFVFN----


                         .         *         .         .         .         .         +:350
query           VISIPLSYFGGIGASSRAGILVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLA
PF00122         PLAVTIALAVGAGRMAKDGVLVRG----------------------------------------------
PF00702         ---------------------------------ADVICFDKTGTLTDNE---------------------
PF08282         ----------------------------------------------------------------------
PF06480         ------SFFGRSGGSSQE---ISYSEFLSYLDQGQVIVGDVSGTLTDGESFVTYVPP-------------


                         .         .         .         .         *         .         .:420
query           AIAESSSPHPIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG
PF00122         ----------------------------------------------------------------------
PF00702         --------HPIAEAIVKELGLPLLPEEEVEALAGRGVRGIERLLLEARLTAELL--LELEGVVSLEEKLG
PF08282         ----------------------------------------------------------------------
PF06480         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ
PF00122         ----------------------------------------------------------------------
PF00702         TAELLERDLELLGLTAIEDPLRPGVPEAIEKLRRAGI-KVWMLTGDNPETAIAIAKRLGIADEFDIVVTS
PF08282         ----------------------------------------------RELFGDRLSVVRSGPN-NLEILPK
PF06480         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIx
PF00122         ----------------------------------------------------------------------
PF00702         DEVGFAKRIVEALQVRGEIVMVGDGVNDAPALKAA-----------------------------------
PF08282         SKGNALKKLLEHLGDPEEVIAFGDSLNDLEMLELAGLGVAMGNAHPEVKA-AADYVTGSNNEDGVAKAL-
PF06480         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00122         ----------------------------------------------------------------------
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------
PF06480         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxx
PF00122         -------------
PF00702         -------------
PF08282         -------------
PF06480         -------------