[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00459.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
    7::159     3e-18  38%  163 aa  PF09250 Prim-Pol "Bifunctional DNA primase/polymerase, N-terminal"
    6::62      4e-04  33%   66 aa  PF08708 PriCT_1 "Primase C terminal 1 (PriCT-1)"
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxRGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLAKSNLIIVDID
PF09250         ------------RGWPVLPLDPGGKRPLSPHGWQDATTDPEQIRRWWTRYPGANIGLATGPSGLVVIDVD
PF08708         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NHNNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTKFIDGVDLLSDFVVTSPSTNY
PF09250         TKAG--ADALAALEAAGGPLPPTLTVRTPSGGRHIYFRVPDGVELPRNLGFLTGIDIRADYVVAPPSIHY
PF08708         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KILNGATLDDIPQTPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVDAGNRNNWIASIFGK
PF09250         EWLPGSPVADLPLLP-------------------------------------------------------
PF08708         -----------------------------------------------------GIVEGGRNCTLFELARR


                         .         .         .         +         .         .         .:280
query           LLRAGASPKNAYSLLQLINDNYVQPPLPAKELDNVAESILKxxxxx
PF09250         ----------------------------------------------
PF08708         LAYRGVREERVYALALAANSN-LSPPLPESEVRAIAKSIAK-----