[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00490.1

[Show Plain Result]


## Summary of Sequence Search
    1::197
    4::47      5e-06  41%   47 aa  PF00440 TetR_N "Bacterial regulatory proteins, tetR family"
    1::197

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQLxxxxxxxxx
PF00440         -----------------AALRLFAERGYEATSVRDIAAAAGVSKGTFYRHFGSKEALLEAL---------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00440         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00440         ---------------------------------------------------------