[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00499.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
   63::195     2e-04  27%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGMTSIILAI
PF00528         -------------------------------------------------------------GLLAVILAL


                         .         .         .         +         .         .         .:280
query           AISSWTTMARMIRAETLSLKTQEYVLAARTLGESPTKIAWKHLVPNLSSIIIIQTMYTIPSAIFFEAFLS
PF00528         VLST-APFVRLIRRAALESIPKDLIEAARALGASRWQTFRRVILP-----LALPGIITGLILAFIGALGE


                         .         *         .         .         .         .         +:350
query           FIGIGITAPETSLGVLLNEGQKNFQFLPYQMWYPAIVLCVLMIAFNLLGDGLRDAFDPKTRx
PF00528         FVIAELLGGGPGLGSLLLLALLGYDY-NLVMAGAAAALALLLLLLNLLADLLQRYLDPLLR-