[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for lsal0:ABE00528.1

[Show Plain Result]


## Summary of Sequence Search
    1::463
    2::183     2e-58  61%  184 aa  PF03796 DnaB_C "DnaB-like helicase C terminal domain"
    3::103     3e-28  53%  103 aa  PF00772 DnaB "DnaB-like helicase N terminal domain"
    1::154     8e-04  27%  202 aa  PF06745 KaiC "KaiC"
    1::463

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT
PF03796         ----------------------------------------------------------------------
PF00772         -----------PHSIEAEQAVLGALLLDPEAIDEVAEILKPEDFYRPAHRKIFKAILDLYNEGEPIDLVT
PF06745         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEExxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03796         ----------------------------------------------------------------------
PF00772         VAEELERRGLLEEVGGLAYLAELASNVPSAANIEYYARIVRE----------------------------
PF06745         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLPTGYREFDKMTAGLQPDNLIILA
PF03796         ----------------------------------------------IPTGFKDLDKLTGGLQPGDLIIIA
PF00772         ----------------------------------------------------------------------
PF06745         ----------------------------------------------LSTGIEELDRVLGGLVPGSVVLIG


                         .         .         .         +         .         .         .:280
query           ARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVA
PF03796         ARPGMGKTAFALNIALNAAKKQGKPVLIFSLEMSAEQLAMRLLASESRVDLKKLRTGRLTDEDWERLTKA
PF00772         ----------------------------------------------------------------------
PF06745         GDPGIGKSTLLLQFAANGARRGE-KVLYVSGEESAQQIKLRA----------------------ERLGLD


                         .         *         .         .         .         .         +:350
query           MGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA
PF03796         AGELSEAPLYIDDTPGLTIDEIRAKARRLKREHG-LGLIVIDYLQLMSGSGRENRQQEISEISRSLKALA
PF00772         ----------------------------------------------------------------------
PF06745         LEELEEELVILDASPPLDLEELLERIRE-AIEELKPKRVVIDSIQTLSAPGSVA---QVREFLAALTRFA


                         .         .         .         .         *         .         .:420
query           KELSVPILALSQLSRGVExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03796         KELNVPVIALSQLNRGVE----------------------------------------------------
PF00772         ----------------------------------------------------------------------
PF06745         KQRGITILLVGHVTK-------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03796         -------------------------------------------
PF00772         -------------------------------------------
PF06745         -------------------------------------------