[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD98850.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1wytA1.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1lk9A.bssp"
#ERROR : Can't open dsspfile "2aeuA1.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "2cbiA1.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1w9gA1.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "1v8dA.bssp"
#ERROR : Can't open dsspfile "1elqA.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "2bkwA1.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"

## Summary of PDB Search
:380
    1e-75  38%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    6e-48  26%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    6e-34  11%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    1e-29  11%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-29  12%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    2e-28  12%  1qz9A  [c.67.1.3] KYNURENINASE
    2e-28  11%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    1e-27  15%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    2e-27  13%  1wytA1 [c.67.1.7] GLYCINE DEHYDROGENASE (DECARBOXYLATING) SUBUNIT
    1e-25  11%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    3e-24  11%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    8e-24  12%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    1e-22  12%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    4e-20  11%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    4e-18  13%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    7e-18  13%  1lk9A  [c.67.1.1] ALLIIN LYASE
    2e-16  18%  2aeuA1 [c.67.1.8] HYPOTHETICAL PROTEIN MJ0158 A:9 -- 374
    2e-14  11%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-14   9%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    5e-14  13%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    1e-13  11%  2cbiA1 [a.246.1.1] HYALURONIDASE A:496 -- 624
    1e-12  14%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    1e-11   9%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-10  13%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    1e-10  13%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    2e-10   9%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    5e-10  15%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    7e-10  10%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    7e-10  11%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    8e-10   9%  1w9gA1 [d.330.1.1] ENHANCER OF RUDIMENTARY HOMOLOG A:1 -- 103
    7e-08  10%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    2e-07   5%  1v8dA  [c.140.1.1] HYPOTHETICAL PROTEIN (TT1679)
    1e-06  17%  1elqA  [c.67.1.3] L-CYSTEINE/L-CYSTINE C-S LYASE
    6e-06   9%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    9e-06  10%  1c8nA  [b.121.4.7] COAT PROTEIN
    1e-05  13%  2bkwA1 [c.67.1.3] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1 A:3 -- 384
    4e-05  10%  1c7nA  [c.67.1.3] CYSTALYSIN
    9e-05  16%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    8e-04  10%  1d2fA  [c.67.1.3] MALY PROTEIN
:380

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIADLEGGVXXXX
1cs1A           -KQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGAGAVL
1cl1A           -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
1pmmA           -------------------LMDLSINKNWIDKEEYPQSAAIDLADLWHAPAPKNGQAVGTNTIGSSEACM
1b9hA           -------------------------------------------WWRMGGDEVNSFEREFAAHHGAAHALA
1ecxA           -------------------------------------PNSAHGMGIEANLHMEKAREKVAKVLGVFTSCA
1qz9A           ----------------SLGARPVAALARAQAVIAEEWGNGRSWNSAGWRDLSERLGNRLATLIGDTTSIN
1c0nA           --FSVDAVRADFPVLSREVNGLPLAYLDSAASAQHGYAAVAHTLSAQATEKMENVRKRASLFINARSAEE
1mdoA           ------------------------------------------SGWITTGPKNQELEAAFCRLTGNAVAVS
1wytA1          ------------------------------------------EVSQGVLQATFEYQTMIAELAGLEIANA
1h0cA           -------------------------------------------MSKDMYQIMDEIKEGIQYVFQTRNPLT
3bc8A1          --MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRQPKAGSSLLNKITNSLVLNVIKLAGVVPMAT
2fn6A1          ----------------------------------------------TQGKRSLLFEEALCEFLGVKHALV
1fc4A           -----HVINFCANN-YLGLANHPDLIAAAKAGXDSHGFGASVRFICGTQDSHKELEQKLAAFLGXEDAIL
2bwnA1          -------------------------------------GSGGTRNISGTTAYHRRLEAEIAGLHQKEAALV
1wytB1          -------------------------------------PYQDPRTAQGALRLMWELGEYLKALTGGAHGEL
1lk9A           ----------------------------------------------------------------------
2aeuA1          ----------------------------------------------------------------------
1dtyA           ----------------------------------------------------------------------
1agxA           HTDKPIVLVGSMRPSTALSADGPLNLYSAVALASSNEAKNKGVMVLMNDSIFAARDVTKGINIHTHAFVS
1vefA1          -------------------------------------------PQTLPTPMRGEFYRTLTAILPPFPVNS
2cbiA1          ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------
1lc5A           -----------------------------------------DCIERYPDADYFHLHQALARHHQVPASWI
1m32A           ----------------------------------------------------------------------
2gb3A1          -----------------------------------------AGIWELREAFASYYKRRQRVDVKPENVLV
1bw0A           ----------------------------CNGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVL
2e7iA1          -------------------------------------------------PIHDFIHNQLPKFLGCDVARV
1u08A           -----------------------------------------YAPMTGVQALREAIAQKTERLYGPDADSD
1iugA           -------------------------------------------RTEAAREVFLKARGLLREAFRTVLILT
1w9gA1          ----------------------------------------------------------------------
2cfbA1          -----------------------------------------TSFGAPCLLENILAEMVIAAVPSVEMVRF
1v8dA           -------------------------------------------VAVQACEHLLVVERETARAFGKEEVAV
1elqA           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
1c8nA           ------------------------------------------------NSTVVSNSELILNLTPIALAYT
2bkwA1          ----------------------------------------------------------------------
1c7nA           ---------------------------------DETVLGYTGPTEEYKKTVKKWMKDRHQWDIQTDWIIN
1vp4A           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYF
1cs1A           TNTGMSAIHLVTTVFKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLV
1cl1A           FPCGAAAVANSILAFEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
1pmmA           LGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRDPKRMIEACDENTIGVVP
1b9hA           VTNGTHALELALQVMGPGTEVIVPAFTFISSSQAA----QRLGAVTVPVDVDDPEAVAAAVTPRTKVIMP
1ecxA           TESINWILKTVAETFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVEKLVDEDTFLVSI
1qz9A           LFKVLSAALRVQATRSPERRVIVTETSNFPTDLIAEGLADMLQQGYTLRLVDSPEELPQAIDQDTAVVML
1c0nA           LVFVRGTTEGINLVANSGDNIIISQMEHHANIVPWQMLCARVGAELRVIGTLQLETLPTLFDAATRLLAI
1mdoA           SATAGXHIALXALGIGEGDEVITPSXTWVSTLNXI----VLLGANPVXVDVDLXVTPEHIEAAITPQTKA
1wytA1          SMYDGATALAEGVLLATGRMVLVSQGVHPEYRAVLRAYLEAVGAKLLTLPLEGGRTPLPEVGEEVGAVVV
1h0cA           LVISGSGHCALEAALVNVDSFLVGANGIWGQRAVDIGERIGVHPMDPGGHYTLQEVEEGLAQHKPVLLFL
3bc8A1          GMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDDLKAVEAKIQELGPEHIL
2fn6A1          FNSATSALLTLYRNFSEFSADRNEIITTPISFVATANMLLESGYTPVFAGIKDELALEKLINERT---KA
1fc4A           YSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDXQELEARLKEARERHVLIAT
2bwnA1          FSSAYNANDATLSTRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNAHLRELIAADDPAAPKLIAF
1wytB1          TGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPASMAGYQVREIPSGPEGEVDLEALKRELGPHVAALML
1lk9A           ----------------------------------------------------------------------
2aeuA1          ----------------------------------IERSCKIVNAKY--FESDKVGEILNKIDKDTLVIIT
1dtyA           --------FGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVII
1agxA           QWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIV-YGSDNMMPDAYQAFAKAGVKAIIH
1vefA1          GTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVIL
2cbiA1          -------------------------SSKEDASALIEELYGEFARMEEACNNLKANLPEVALEECSR-QLD
1b8gA           -----------------YPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQEAEKRNLRVKGVLV
1lc5A           LAGNGETESIFTVASGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREWQLTDAILEALTPDLDCLFL
1m32A           --------AVLGSALGPQDKVLIVSNGAYGARXVEX--AGLXGIAHHAYDCPDVQAIDAILNADPTISHI
2gb3A1          TNGGSEAILFSFAVINPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRXEFAIPQNLESFINERTKGIVL
1bw0A           CSGGSHGILMAITAICDADYALVPQPGFPHYETVCKAYMHFYNCRPENDWEADLDEIRRLKDDKTKLLIV
2e7iA1          TNGAREAKFAVMHSLKKDAWVVMDENCHYSSYVAAERVPKTDYPDYAIPENFAQTIEETKKRGEVVLALI
1u08A           ITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMFRVDWQEFAALLSERTRLVIL
1iugA           GSGTLAMEALVKNLFAPGERVLVPVYGKFSERFYEIALEAGLVVERLDYPYGDTPRPEDVAKEGYAGLLL
1w9gA1          ------------------------------TILLVQPTKRPEGRTYADYENECMEGVCKMYEEHLKRMNP
2cfbA1          VNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHAATLTAPYN------DLEAVSRLFEQYPNDIAGVIL
1v8dA           FPHPKAGGAKATAAFLRFRDPVMVESLKAQAHGGMDIGGVLIGMHLRPVAVPKIGEAVLLAAKRPKLVGG
1elqA           ------------------DEILLTDCEHPGIIAIVQAIAARFGITYRFFPVAAAAVLANHLGPKTRLVIL
1vk9A           ------------------------------------------------VEKNLLRSALKIFEKKDLAYSG
1c8nA           VQ-------SLPLIATQPAWLGTIADNYSKWRWVSLRISPKCPTTTSGTVAMCLSYDRNDVAPGSRVQLS
2bkwA1          --------------KAPNKNVLVVS--TGTFSDRFADCLRSYGAQVDVVRPLPLELITEKLSQNSYGAVT
1c7nA           TAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELLETIDFQKLEKLSKDKNNKALL
1vp4A           ----------------------------------------------------------------------
1d2fA           --------ELIRQWSETGEGVVIHTPAYDAFYKAIETVMPVALEKQADGWFCDMGKLEAVLAKPECKIML


                         +         .         .         .         .         *         .:210
query           ETPTNPLLQXXXXXXXXXXXXXXXXXXXVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVT
1cs1A           ESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTXYLNGHSDVVAGVVIA
1cl1A           ESPGSITMEVHDVPAIVAAVRSVVPDAIIMNTWAAGVLFKALDFGIDVSIQAATXYLVGHSDAMIG-TAV
1pmmA           TFGVTYTGNYEFPQPLHDALDKFQADTGIDAASGPDIVWDFRLPRVKSISASGHKFGLAPLGCGWV-IWR
1b9hA           VHMAG-LMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGA-VVF
1ecxA           MAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIPFSLEKLEVDYASFSAHKFHGPKGVGITY--IR
1qz9A           THVNYKTGYMHDMQALTALSHECGALAIWDLAHSAGVPVDLHQAGADYAIGCTYKYLNGGPGSQA--FVW
1c0nA           THVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHPVDVQALDCDFYVFSGHKLYGPTGIGILYVK--
1mdoA           IIPVHYAGAPADLDAIYALGERYGIPVIEDAAHATGTSYKGRHIGARGTAIFSFHAIKNITCAEGGIVVT
1wytA1          QNPNFLGALEDLGPFAEAAHGAGALFVAVADPLSLGVLKPPGAYGADIAVGDGQSLGLGFGGPHFGFLAT
1h0cA           THGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGTPLYMDRQGIDILYSGSQKALNAPPGTSLI--SF
3bc8A1          CTACFAPRVPDRLEELAVICANYDIPHVVNNAYGHLIQQGARVGRIDAFVQSLDXNFMVPVGGAIIAGFN
2fn6A1          IVSVDYAGKSVEVESVQKLCKKHSLSFLSDSSHALGSQNKKVGGFALASVFSFHKPITTAE---GGAVVT
1fc4A           DGVFSXDGVIANLKGVCDLADKYDALVXVDENGRGSHEYCDVXGRVDIITGTLGKALGGASGGYTAARKE
2bwnA1          ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPAERDGLMHRIDIFNGTLAXAYGVF-GGYIA
1wytB1          TNPNTLGLFERRILEISRLCKEAGVQLYYDNLNAIMGWARPGDMGFDVVHLNLHKTFTHLAPYLPVPLVE
1lk9A           ----------------------------------------------------------GHSGSRFGWALI
2aeuA1          GTMDLKVIELENFKKVINTAKNKEAIVFVDDASLLFNQPPALKLGADLVVTSTDKLMEGPR----GGLLA
1dtyA           EPIVQGAYHPEWLKRIRKICDREGILLIADEIATTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTT
1agxA           AGTGNGSMANYLVPEVRKLHDEQGLQIVRSSRVAQGFVLRNAEQPDDKYGWIAAHDLNPQKARLLMAKTN
1vefA1          EPVQGEPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAGIVPDILTLAKALGG--GVPLGVAVM
2cbiA1          ELITLAQGDKASLDMIVAQLNEDTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS--------
1b8gA           TNPSNPTMTRNELYLLLSFVEDKGIHLISDEIYSRNCDENSEVWQRVHVVYSLSKDLGLPGFRVG--AIY
1lc5A           CTPNNPLQAIADRCKSLNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNS
1m32A           AXVHSETTTGXLNPIDEVGALAHRYGKTVDAXSSFGGIPXDIALHIDYLISSANKCIQGVPGF--AFVIA
2gb3A1          SNPCNPTYGKDEXRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSIVVIDSVSXKFSACGARVGCLIT
1bw0A           TNPSNPNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPRVILGGTAXNLV
2e7iA1          TYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLEIGADFIVGSGHKSMAASGP--IGVMGM
1u08A           NTPHNPLWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVG--YCV
1iugA           VHSETSTGALADLPALARAFKEKNPEGLVGADMVTSLLVGEVALEAMGVDAAASGSQXGLMCPPGLGFVA
1w9gA1          NSPSITYD--ISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQA--------------
2cfbA1          EPVVGNAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGK--VIGGGLPVGAYGG
1v8dA           ARAVYT----------------------------------------------------------------
1elqA           SHLLWNTVLPLAEIMAVCRRHQGNYPVRVLVDGAQSAGSLPLRLEVDYYAFTGHKWFAGPA-GVGGLYI-
1vk9A           RSFESKDSGLKPVVELFKRFDNLEGSLVIDKXVGKAAASFLLHIHAKVISKPALKLXNEYG--QSFSYDE
1c8nA           QTYKAIILNTDVTPTSAIYVDVDVTRFDKAWYSTIGTAAFAALTAFDQNQFCPCTVHIGSDGGPA--VAV
2bkwA1          VTHVDAVLSDLKAISQAIKQTSPETFFVVDAVCSIGEEFEFDEWGVDFALTASQXAIGAPAG--LSISLC
1c7nA           FCPHNPVGRVWKKDELQKIKDIVLKSDLMGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNIIIK
1vp4A           ------------------------------------------GPERVVLLNTFSKVLAPGLR---IGXVA
1d2fA           LCPTGKVWTCDELEIMADLCERHGVRVISDEIHMPHIPWSNVARGDWALLTSGSKSFNIPALTGA--YGI


                         .         .         .         +         .         .         .:280
query           SDEKIAEKLAFLQNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDF
1cs1A           KDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPEN
1cl1A           CNARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
1pmmA           DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
1b9hA           PDGETEKYETAFLRHSCGRPRDDSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADR
1ecxA           KGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHME-------KLRSKLVSGLMNL
1qz9A           VSPQLCDLVPQPLSGWFGHSRQFAMEPRYEPSNG-IARYLCGTQPITSLAMVECGLDVFAQTDMASLRRK
1c0nA           ----EALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEY
1mdoA           DNPQFADKLRSLKFHGLGVLPDLNAAIALAQLQKLDALNARRAAIAAQYHQAXADLPFQPLSLPSWEHIH
1wytA1          KKA-------------------------------------------------------------------
1h0cA           SDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLNSWRQHREAAAYLHGRLQAL
3bc8A1          EPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHN
2fn6A1          NDSELHEKMKLFRSHHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPYFTPLHPLLKDKS
1fc4A           VVE--WLRQRSRPYLFSNSLAPAIVAASIKVLE-XVEAGSELRDRLWANARQFREQXSAAGFTLAG----
2bwnA1          ASARMVDAVRSYAPGFIFSTSLPPAI-------AAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
1wytB1          RGEEGFYLDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVP
1lk9A           KDESVYNNLLNYMT--KNTEGT--PRETQLSLKVLKEVVAMVKTQKGTMRDLNTFGFKKLRERWVNITAL
2aeuA1          GKKELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNLERNFDLSKIEKLNKELKAIDDNINIVYERT---
1dtyA           RE--VAETISDGEAGCFMHGPT----FMGNPLACAAANASLAILESGDWQQQVA---DIEVQLREQLAPA
1agxA           DAKEIQNMF-------------------------------------------------------------
1vefA1          REE-VARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAA------------ELGPWFMEKLRAI
2cbiA1          ----------------------------------------------------------------------
1b8gA           SNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENH--------KRLKQRQKKLVSGLQKS
1lc5A           DDAAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYPGRANLRC
1m32A           REQKLAACKGHSRSLSEDNHGKWRFTSPTHTVLAFAQALKELAKEGG-VAARHQRYQQNQRSLVAGXRA-
2gb3A1          RNEELISHAXKLAQGRLAPPLLESVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPS-----
1bw0A           GWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGEC
2e7iA1          KEEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEVEKRRFAAEMEKLGIKQL
1u08A           APAPISAEIRKVHQYLTFSVNTALADMLRAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLL
1iugA           LSPRALERLKPRGYYLDLARELKAQKEGESAWTPAINLVLAVAAVLEEVLPRLEEHLALQNALLYGVGEE
1w9gA1          ----------------------------------------------------------------------
2cfbA1          RAEIMKMVAPAGPTLSGNPLAMTAGIKTLEILSRPGSYEHLD-----------RITGKLVQGLLDAAREF
1v8dA           ----------------------------------------------------------------------
1elqA           -HGDCLGEINPTY--VGWRSITYGAKGEPTGWAEGGKRFEVATSAYPQYLQLHQREERYQAILWRGLNQL
1vk9A           KIPFVLGKD-------------------------------------------------------------
1c8nA           PPGDIFFKYVIEL---------------------------------------------------------
2bkwA1          SSRFXDYALNDSKNHVHGYFSSLRRWTPIXENYEAGKGAYFATPPVQLINSLDVAHKRWDLHFKDSLVNG
1c7nA           NPDIRERFTKSRDATSGMPFTTLCEICYKECGKWLDGCIKVIDKNQRIVKDFFEV-------NHPEIKAP
1vp4A           GSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLLEQL----KPTIELYRRKRTVXLNALEEYFSDI
1d2fA           IENSSSRDAYLSALKGRDG----LSSPSVLALTAHIAAYQQGAPWLDALRIYLK---DNLTYIADKMNAA


                         .         *         .         .         .         .         +:350
query           PGHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENG
1cs1A           QGHEIAARQQKGFGAMLSFELDGDEQLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAG
1cl1A           KGHEFWKRDFTGSSGLFSFVLLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEID--
1pmmA           GPYEFICTGRPDEGIPAVCFKL-KDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRI---
1b9hA           NSHYMAMFRIPGLTEERRNALVDRLVEAGPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNDAISSDC
1ecxA           GAHIITPLEI-SLPNTLSVSF-------PNIRGSTLQNLLSGYGIYVSTHVLDAMGVDR----------R
1qz9A           SLADLFIELVEQRCAAHELTLVTPREH--------AKRGSHVSFEHPEGYAVIQALIDRGVIGDYREPRI
1c0nA           EQN-LMHYALSQLESVPDLTLYGPQAR--LGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYY
1mdoA           AWHLFIIRVDEARC---------------GITRDALXASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLP
1wytA1          ----------------------------------------------------------------------
1h0cA           GLQLFVKDPALRLPTVTTVAVPAGYDWRDISYVIDHFDIEIMGGLG------PSTGKVL-----RIG---
3bc8A1          PISLAMTLKTIDGHHDKAV----TQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLN
2fn6A1          SNHLYP----------ILMHQKFFTCKKLILESLHKRGILAQVHYKPIYQYQLQLFNTAPLKSAEDFYHA
1fc4A           -----------ADHAIIPVXLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQAR---------IRTQXS
2bwnA1          GMPIIDHG-----SHIVPVVIGPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
1wytB1          YD--------GPSMHEFVAQPPEGFRALDLAKGL-----------LELGFHPPTVYFPLIVKEALMVE--
1lk9A           LDQSDRFSYQELPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCY-QTFQNGRINTQNGVGF-------E
2aeuA1          PTGFVIKRVYKD----DTINIKKLIEIFNLLKNYGIITIT------------------------------
1dtyA           RDAEM-VADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIRPFGKLIYLMPPYIILPQQLQRLTAVNRA
1agxA           ----------------------------------------------------------------------
1vefA1          PSPKI--REVRGMGLMVGLEL-KEKAAPYIARLEKEHRVLALQAGPTVIFLPPLVIEK------------
2cbiA1          ----------------------------------------------------------------------
1b8gA           GISCLNG----NAGLFCWVDMRHLLRSNTFEAEME---LWKKIVYEVHLNISPGSSCHCTEP--------
1lc5A           EREDID----------------------------------------------------------------
1m32A           LGFNTLLDDELHSPIITAFYSPEQYRFSEFYRRLK-----------------------------------
2gb3A1          -------------GAFYITAELPVEDAEEFARW----XLTDFNXDGETTXVAPLRGFYLTPGLGKK----
1bw0A           IGLAPTMPRGAMYLM---SRIDLEKYRDIKTDVEFFEKLLEEEN----VQVLPGTIFHAPG---------
2e7iA1          GDN-------PHNHDLMFF----------HAEVLYEISKKAKGGRFFLYRELKSRKIHGIKP--------
1u08A           VDYSAVSTLDD--VEFCQWLTQE-----------------------HGVAAIPLSVFCADPFPHKL----
1iugA           GGLRPVPKRFSPA--VAAFYLPEGVPYARVKEAFAQRGAVIAGG------------QGPLKGKVFR----
1w9gA1          ----------------------------------------------------------------------
2cfbA1          GHEVCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFH------RGMLEQGIYLAPSQFEA-------
1v8dA           ----------------------------------------------------------------------
1elqA           PHVHCLATSAPQ-AGLVSFTVDSPLGHRAIVQKLE---------------------EQRIYLRTIADPDC
1vk9A           ----------------------------------------------------------------------
1c8nA           ----------------------------------------------------------------------
2bkwA1          LQLTSVSRYPSNXSAHTAVYVADPPDVIAFLKSHGVV---------------------------------
1c7nA           LIEGTYLQWIDFRA--------LKMDHKAMEEFM--------------IHKAQIFFDEGYIFGD------
1vp4A           PGVKWVKSE----GGLFIWLLPEGFDT-------------------WEXFEYAKRKKVFYVPGRVFKVYD
1d2fA           FPE-LNWQIPQSTYLAWLDLRPLNIDDNALQKAL--------------IEQEKVAIMPGYTYGEE-----


                         .         .         .         .         *         .         .:420
query           IKDELIRLSVGIEDEEDLINDLKQALDKIG
1cs1A           ISETLLRISTGIEDGEDLIADLENGFRAAN
1cl1A           FSGTLIRLHIGLEDVDDLIADLDAGFARI-
1pmmA           ----MCRRGFEMDFAELLLEDYKASLKYL-
1b9hA           VWLHHRVLLAGEPELHATAEIIADAVAR--
1ecxA           IAQGAIRISLCKYNTEEEVDYFLKKIEEI-
1qz9A           MRFGFTPLYTTFTEVWDAVQILGEILDRK-
1c0nA           NVPAMCRASLAMYNTHEEVDRLVTGLQRI-
1mdoA           DTEWICSLPLFPDXTESDFDRVITALHQI-
1wytA1          ------------------------------
1h0cA           ----LLGCNATRENVDRVTEALRAALQHCP
3bc8A1          A---AAAIGMKMQDVDLFIKRLDKCLNIV-
2fn6A1          EISLPCHANLNLESVQNIAHSVLKTFES--
1fc4A           -------AAHTPEQITRAVEAFTRIGKQLG
2bwnA1          -----LRFTPSPVHDLKQIDGLVHAMDLL-
1wytB1          -----PTETEAKETLEAFAEAMGALLKKPK
1lk9A           ASSRYVRLSLIKTQDDQLMYYLKDMVKA--
2aeuA1          ------------------------------
1dtyA           VQD---------------------------
1agxA           ------------------------------
1vefA1          ------------------------------
2cbiA1          ------------------------------
1b8gA           ---GWFRVCFANLPERTLMQRLKAFV----
1lc5A           ------------------------------
1m32A           ------------------------------
2gb3A1          ----EIRIACVLEKDSRAIDVLXEGLK---
1bw0A           ----FTRLTTTRPVEREAVERIKAFCQRHA
2e7iA1          GLTRYFKLSTYGLSDEEVLNAFKEIIEK--
1u08A           -----IRLCFAKKEST--LLAAAERLRQL-
1iugA           -----LSLMGAYDRYEGVAGMFREVLEEI-
1w9gA1          ------------------------------
2cfbA1          -----GFTSLAHTEAERTIAAARTVLSQL-
1v8dA           ------------------------------
1elqA           -----IRACCHYITDEEEINHLLARLADFG
1vk9A           ------------------------------
1c8nA           ------------------------------
2bkwA1          ------------------------------
1c7nA           GGIGFERINLAAPSSVESLERLNKALKDL-
1vp4A           EPSPSXRLSFCLPPDEKIVEGIKRLREVV-
1d2fA           -GRGFVRLNAGCPRSEKGVAGLINAIRAV-