[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for lsal0:ABD98930.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1q12A1.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "3d31A1.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1oxsC1.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "2bsqE1.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1g2914.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1v43A2.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"
#ERROR : Can't open dsspfile "1g2913.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2bdtA1.bssp"

## Summary of PDB Search
:362
    1e-54  31%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    1e-50  21%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    1e-44  14%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    1e-44  24%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    6e-44  20%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-42  27%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    3e-42  18%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-42   3%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-41  18%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    3e-40  13%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-38  11%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    2e-36  29%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    2e-35  13%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-35  13%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-34   8%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-33  13%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    5e-32  12%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    3e-31  12%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    6e-31  18%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    2e-30  14%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    4e-30  10%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    5e-30  14%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    1e-29  15%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-29   9%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    3e-29  13%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    4e-29   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    5e-29   4%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    8e-29   9%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    2e-28  27%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-28  17%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    5e-28  14%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    7e-28  15%  1rkbA  [c.37.1.1] PROTEIN AD-004
    1e-27  28%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-27  13%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    4e-27   9%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    6e-27  12%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-26  12%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    4e-26  17%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    3e-25  16%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    4e-25  14%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    7e-25  12%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    8e-25  12%  1jb1A  [c.91.1.2] HPRK PROTEIN
    1e-24  12%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    2e-24  13%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    2e-24   9%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    6e-24  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    2e-23  13%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    2e-23  11%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    6e-23  13%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-22  11%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-22  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    2e-22   9%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    2e-22  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    3e-22  14%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    4e-22   9%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    6e-22  14%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    9e-22  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    9e-22  18%  1sbxA  [a.6.1.4] SKI ONCOGENE
    3e-21  10%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    6e-21  13%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    6e-21  12%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    7e-21  10%  1mi8A  [b.86.1.2] DNAB INTEIN
    8e-21  11%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-20  11%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    4e-20  11%  1jbkA  [c.37.1.20] CLPB PROTEIN
    4e-20  17%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    5e-20  12%  1g6oA  [c.37.1.11] CAG-ALPHA
    7e-20  16%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    8e-20  19%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    1e-19  14%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    1e-19  13%  1q12A1 [b.40.6.3] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING A:236
    1e-19  14%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-19   6%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    2e-19  13%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    2e-19  10%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    3e-19   9%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    3e-19  12%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    3e-19  11%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    7e-19  10%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-18   6%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-18  14%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    3e-18  13%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    3e-18  18%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    4e-18  10%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    4e-18  16%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    2e-17  13%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    6e-17  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    6e-17  18%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    7e-17  12%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    7e-17  12%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    1e-16  20%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    4e-16  18%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    4e-16  12%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    5e-16  15%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    6e-16  12%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    1e-15  14%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    1e-15   9%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    3e-15  16%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    4e-15  10%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    5e-15  13%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    6e-15  12%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    1e-14  13%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    2e-14  17%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    4e-14  19%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    5e-14  17%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    6e-14  16%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    7e-14   9%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    8e-14  22%  3d31A1 [b.40.6.3] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-13  16%  1g31A  [b.35.1.1] GP31
    1e-13  17%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    4e-13   9%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    5e-13   9%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    1e-12  14%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    2e-12   8%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    5e-12  11%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    7e-12   9%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    1e-11  16%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    2e-11  14%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    3e-11  13%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    4e-11  18%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    8e-11  24%  1oxsC1 [b.40.6.3] ABC TRANSPORTER, ATP BINDING PROTEIN C:243 -- 352
    1e-10  21%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    1e-10  11%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    1e-10  15%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    2e-10   7%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    5e-10  12%  2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
    2e-09  17%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    1e-08  10%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    2e-08   9%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    2e-08  16%  1g2914 [b.40.6.3] MALTOSE TRANSPORT PROTEIN MALK 1:302 -- 372
    5e-08  17%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    6e-08  10%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    1e-07   8%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    2e-07  19%  1v43A2 [b.40.6.3] SUGAR-BINDING TRANSPORT ATP-BINDING PROTEIN A:304
    4e-07  10%  1oa8A  [b.145.1.1] ATAXIN-1
    5e-07  16%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    1e-06  15%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    1e-06  19%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
    2e-06  24%  1g2913 [b.40.6.3] MALTOSE TRANSPORT PROTEIN MALK 1:241 -- 301
    2e-05  16%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    1e-04  15%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
    1e-04  14%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    3e-04  11%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    3e-04  28%  2bdtA1 [c.37.1.25] BH3686 A:1 -- 176
:362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATSGDVYFDGKRI
1b0uA           ----KLHVIDLHKRYGG-HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNI
1sgwA           ----KLEIRDLSVGYDK--PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGV--
1m3eA1          ------------------YTDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGV
1l7vC           ----------IVXQLQDESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGX-TSGKGSIQFAGQPL
1q3hA           FGELLEKVSFSHLCLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVS
1ji0A           VSDIVLEVQSLHVYYGA-IHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDI
1e69A           ---------RLKKLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENL
1t06A           -------------------KTVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAE
1mukA           --------RARRHSYSS-FSKLLEAYLLVKW-----RMCEAREPSVDLLPLCAGI-DPLNSDPFLKMVSV
1ex6A           --------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRT
1e9rA           -----GKLKRMTREKAK-QVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1pf4A1          --NGEVDVKDVTFTYQGEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDV
1nijA1          -------------------------------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGE
2yyeA2          -------------------------QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLAL
1khbA1          --------------WLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWM
1urjA           --KHETTGEALCERLGLDLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSR
1jjvA           -------------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVV
1bmfA3          -----IPRISVREPMQT-GIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY
1ohcA1          ----------------------------------------------------------PQDDVYLDITDR
1qhlA           -----GKFRSLTLIN---WNGFFARTFDLDEL-VTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHG---K
1j1zA2          ----------------------------------------------------------------------
1pv4A3          -----ILFENLTPLHEDLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLI
1ffhA2          ----------------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADT
1mjgM           METRGIKLTKIKLDLPI-NFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDID
1jalA1          -------------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPM
1grqA           -------------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIE
2iqhA1          ILYDKEEIRRIWRQANNTHMMIWHSNLNDATYQRTRALVRTGMDPRM-CSLMQGSTLPRRSGAA--GAAV
2gx8A1          --------------------------EVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLEIETIIPAS
1vplA           -----VVVKDLRKRIGK-KEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNV
1mm8A           ----------------------------------------------------------------------
1n25A           -------HCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRL
1rkbA           ----------------------------LMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREE
1g6hA           ---EILRTENIVKYFGE-FKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI
1bgxT2          -------------------------------------------------RGMLPLFEPKGRVLLVDGHHL
2gk3A1          ----------------------------------------------------------------------
2v3jA1          --------------------APPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDD-HQGLLKKXGRDI
1s9hA           --------LNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFP
1dhyA1          ----------------------------------------------------------------------
1xbtA1          -------------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAK
1kgdA           -------------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRP
1dnpA2          ----------------------------------------------------------------------
1jb1A           -----------------ERRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQ
1f46A           ----------------------------------------------IIMNVAAHHGSELNGELLLNSIQ-
2axpA1          ---------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAK
1afrA           -----------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPAS
1udwA           ------------------------------EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYR
1bs2A1          ----------------------------------------------------------------------
1i1qA           DLTKVDRYSYVMHLVRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGG-----
1t3wA           --------------------------------------------KRTTXRILIGLQNPELATLVPPLENL
1g8yA           ----THKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLLQLAAQI-------------AG
1tljA           --------------EELREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYT-QSSCSGRITIVDAEM
1es6A2          ----------------------------------------------------------------------
1e6cA           --------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHT
1zp6A1          ------------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWG
1d6jA           -----------------ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
1fl9A           MESQYIPDEFSMLRFGK-KFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLV
1c4oA1          -----FRYRGPSPKGDQ-PKAIAGLVEALRDGERFVTLGATGTGKTVTMAKVIEALGRPALVLAPNKILA
1sbxA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1tmkA           -------------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERST
1cd5A           HKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQKIRSY
1mi8A           ---KRVSIKDLLDEKDFEIWAINEQTMKLESAKV-SRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDG
1ak2A1          -------------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAM
1l3aA           ----------------------------------------------------------FVGYSIYKGKAA
1jbkA           -IDLTERAEQGKLDPIGRDEEIRRTIQVRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRV
1cr0A           ----LSSEESVGLLFSG-CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
1g6oA           YPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEE
1a4iA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1q12A1          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1zs3A1          -------------------------------------------------------------------LMI
1l7lA           ---------------------KGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHP
1esmA           --LPLSRLLNFYISSRQAVLEQFLGTNGQRIPYIISIAGSVAVGK------------------STTARVL
1e3mA2          --KPGIRITEGRHPVVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKV
1vhhA           ----------------------------------------------------------------------
1np6A           -------------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTH
2qgmA1          ----------------------------------------------------------------------
1ovmA2          FLDHVIDSPDICWVGANELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPG
1em8A           ----------------------------------------------------------------------
1atrA1          ----------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
1qhdA1          -------IKFKRINFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVRQEY-AIPVGPVFPPGMNW
2vgmA3          ----------------------------------------------------------------------
1viaA           --------------------------------KNIVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQK
1poiA           ------------------MTLKDAIAKYVHSGDHIALGGFTTDRKAAVFEILRGLGGAAGGDW---DMLI
1lw7A2          ----------------------------PFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVF
1iqrA2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f2t.1          -------------------------------------------------------------AIYIRQGQI
1q3tA           -------------------------------TIQIAIDGPASSGKSTVAKIIAGFTYLDTGAMYLGVEEV
1ni3A1          ----------------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDP
1xl3C1          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
3cddA2          --EIVLKAGGKIYQGWGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGY
1uouA3          ----------------------------------------------------------------------
1b77A2          ---------------------VASVITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNK
1o7d.2          ----------------------------------------------------------------------
1ckeA           -------------------------------APVITIDGPSGAGKGTLCKAMAEALQWDSGAIYRDVASE
2ancF1          ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLA
1ckvA           -----SNAYDGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGK
1ii8.1          ----------------------------------------------------------------------
1t9hA2          --------------------DSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISPTLIHTSGGLVADTPGF
1iioA           ----------------------------------------------------------------------
1mkyA1          -------------------------------ATVL-IVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKL
2gtlM1          DHAIVTITAAHRKSFRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPL-KGQSEGYGVICDFN
3d31A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2hA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWR-VL
1tueA           -------LRYQQIEFITFLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHF
1yr6A1          ---------------------------------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTG
1yvuA2          ------------------------------KGKSLILAQTREEAKEKLIPVINKIKDVDLVIVFLEFLLY
2vnuD1          --KVRIRTRRAAELLDK-RIVISIDSWPTTLGHFVRDLGTIESAQAETEALLLEHDVEYR----------
1l1oA           --------------MDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFI--LSDGEGKNGTIELMEP
1w1wA           --------------------------VGFGESNFTSIIGPNGSGKSNMMDAISFVLG-VLKDLIYRGPQI
1oxsC1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------VKKGSDPYFTLQAVLDDQSSGRVTLYDVNF
1yj5A2          --------------------------------------GFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQ
1g8fA3          ----------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEH
1jqjA3          -----DLLKQAARAAAASNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGA--------EMEIG
2bsqE1          ----------------------------------------------------------------------
1odfA           --------------------------------------GPQGSGKSFTSIQIYNHGEKSIGYASIDDFYL
1v37A           ----------------------------------------------------------------------
1pgsA2          -QYNKSSIDGVPYGKAHGLKKNIQLPTNTEKAYLRTTIGWGHAKPYDAGSRGCAEWCFRTHTIAINNANT
1g2914          ----------------------------------------------------------------------
2je6I3          -----------------------GIVIDIMPVKVPRVIGKNKSMYETL--TSKSIFVANNGRIWAFSEEI
1dwmA           ----------------------------------------------------------------------
1heiB1          ----------------------------PQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVGSP
1v43A2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1p5zB           -------------------------------IKKISIEGNIAAGKSTFVNILKQVARWCNVQSTNGGNVL
1jqjA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------LPIGRSTLVSGTSGTGKTLFSIQFLGIIEFDEPGVFVTFEEP
1g2913          ----------------------------------------------------------------------
1j90A           -------------------------------PFTVLIEGNIGSGKTTYLNHFEKYEPVEKWRNVNGVNLL
1l8qA2          ---PKYTLENFIEGNRLAYEVVKEALENLGSLYNPIFIGSVGTGKTHLLQAAGNEAKKRGYRVIYEHLKK
4tmkA           -------------------------------SKYIVIEGLEGAGKTTARNVVVETLEQLGIRDMVFTREP
1e6vC           ----------------------------------------------------------------------
2bdtA1          --------------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSEGDIINHPWES


                         .         .         *         .         .         .         .:140
query           NDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGG
1b0uA           NLVRDKRTRLTMVFQHFNLWSHMTVLENVMEAPQVLGLSKHDARERALKYLAKVGIDEAQGKYPVHLSGG
1sgwA           -PITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEI---MDALESVEVLDLKKKLGELSQG
1m3eA1          DNSKQIKRXISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGVPAFYTSTGYGTLVQEGGSPIKYN
1l7vC           EAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRT---ELLNDVAGALALDDKLGRSTNQLSGG
1q3hA           FCSQFSWIMPGTIKENIIFGVS--------YDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGG
1ji0A           TNKPAHVINRALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGG
1e69A           PPAGSAYVGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGG
1t06A           ELYATGNYDAMYFAGIIADPKAMSESDFDRW------IDGAYFYMLSDYVVAVTLSESNIAQDVIASGDE
1mukA           GPMLQSTRKFAQTLFMAKTVSGLDVIDSALLRLRTLGAD----KKALTAQLLMVGLQESEDALAGKIMLQ
1ex6A           PRAGE-VNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVK
1e9rA           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
1pf4A1          RDYKLTNLRRHFALVSQNVHLFNDTAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGG
1nijA1          VSVDDQLIRATQIKTLTNGCICCSRSNELEDALLDLLDNLDKGN----IQFDRLVIECTGMADPGPIIQT
2yyeA2          NDKDATACTDVTGFGLLGHAWNICKNSNIGARIFFEKVPYYQLSENLVKIYPKGAIENLNFVKNYLKSNL
1khbA1          KFDAQGHRAINPENGFFGVAPGTSVKTNPNAIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNK
1urjA           VIANHRSIGEKFTYPLPFFNRPLNVVGPAAVALRSRNVDAAAAHLAFDENHEGAALPADITFTAFAGGFE
1jjvA           AKDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKL-------------WLNNLLHPAIRERMKQKLAEQ
1bmfA3          CIYVAIGQKRSTVAQLVKRLTDIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVA
1ohcA1          LCFAILKSASNVHYFSNELEYE-NFYAD--FGPLNLAMV-YRYCCKINKKLKSITMLR--KKIVHFTGSD
1qhlA           LKAGVCYSMLDTINSRHGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAITDY
1j1zA2          -------MDANLLHISYEGGVLEDPWAEPPKGM----FRMTQDPEEAPDAPEYVEVE-FFEGDPVAVNGE
1pv4A3          DERPEEVTEXQRLVKGEVVASTFD--EPASRHVQVAEXVIEKAKRLVEHKKDVIILLDSITR------LA
1ffhA2          QRPAAR-------EQLRLLGEKVGVPVLEVMDGESPESIRRRV--------EEKARLEARDLILVDTAGR
1mjgM           QIPEGSKLPLGILVDIYGRKMQADFEGVLER--RIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFK
1jalA1          PDPRLDALAEIVERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDIDT
1grqA           AMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGD
2iqhA1          KGVGTMVMEIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNAEFEDLIARSALILRGS
2gx8A1          LQRKVIKAMVTAHPYEEVAYDVYPLDNKGETL---GLGKIGYLQEEMTLGQFAEHVKQSLDVKGARVVGK
1vplA           VEEPHEVRKLISYLPEE--AGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTY
1mm8A           ----------KSVFSSAALGDARLVNVAAQLAKKSITISSEGSKAAQEGAYRFIRNPNVSAEAI--RKAG
1n25A           NFELGVAKGTGGESRDLPSGQGINNLDNLRDYLDGSVKLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQAR
1rkbA           QLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERVLRTDTNVLYERLETRGYNEKKLT
1g6hA           TNKEPAELYHYGIFQTPQPLKEMTVLENLLIGEICPGESPEEMVEKAFKILEFLKLSHLYDRKAGELSGG
1bgxT2          ------------AYRTFHALKGLTTSRGEPVQAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGR
2gk3A1          ------------LFIGESWH----IHXIHSKGYDSTSSKYEEGATWLLECLRKGGVDIDYIAFPESIDEL
2v3jA1          SEARPDICLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRSEEKLL
1s9hA           FN-DCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRV----DQKCKSSAQIDPTPVIVTSNTNMCAVIDG
1dhyA1          -----------------------------------------RLGYLGFAVKDVPAWDHFLTKSVGLMAAG
1xbtA1          DTRALPACLLRDVAQEALGVAVIGIDEGQFF------PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGA
1kgdA           PEENGKNYYFVSHDQMMQDISN--------NEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQAL
1dnpA2          ----------------VWFRQDLRLHDNLAL-----------AAACRNSSARVLALYIATPRQWATHNMS
1jb1A           DEQT-IVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVHLENWTPDQLIFDPKITVPVKVG
1f46A           --------QAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDTPGVTIFMQVPSYGDELQL
2axpA1          SGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSLRFIEDKIKAKAKVVYLHADPSVIKKRLGKD
1afrA           DGFDEQVRELREIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTEN-SPYLGFI
1udwA           VLTSEQALKGQFNFDHPDAFDNELILKTLKEI----------TEGKTVQIPVYDFVSHSRKEETVTVYPA
1bs2A1          ----------------------------------------------------------YLQYAHSRLRSV
1i1qA           --------AVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADET---RNKA-----RA
1t3wA           DE-----NKLPGLGLFRELVNTCLSQPGLTTGQLLEH-YRGTNNAATLEKLSXWDDIADKNIAEQTFTDS
1g8yA           GPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDG
1tljA           PWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIWDILKIAREAGFKHSGILAT
1es6A2          -----------------ALRPGISFHPKLRPILNSADLTSPEKIQAIMTSLQDFKIV--PIDPTKNIMGI
1e6cA           SGMVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFLQASLQAHQRPTLT
1zp6A1          YIKH--GRIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFPLHYIVLRTTAAEAI
1d6jA           NIRFGLNKDLGFSEADRNENIRRIAEV-------AKLFADSNSIAITSFISPYRKDRDTARQLHEVATPG
1fl9A           EEYNIAGKMI--YHFDLYRLADPEELEFMGIYFNTDSICLIEWSEKGQGILILVNIDYYDDARNIELIAQ
1c4oA1          AQ---------LAAEFRELFPENAVEYFISYYDYYQPE--AYVPGKDLYIEKDASINPEIERLVVASVSA
1sbxA           ---------------------------------------------------------GSHXFXPSDRSTE
2f9hA1          ATVTEIGKHAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVGSFANS
1tmkA           RIGGLINEYLTDDSFQL--SDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGM
1cd5A           GKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVVGTLLDAEEVMILVLGSQKALALQAAVEGC
1mi8A           WRLDELSLKEHIALPRKSDSWDSIVSITETGVEEVFDLTVPGPHNFVANDI-------------------
1ak2A1          VASGSELGKKLKATMDAGKLVSDEMVNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFS
1l3aA           LTVPRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWQVFSLSVTEIGSIISLGTDSCEFFHDPNKG
1jbkA           LALDMGALVAGAKYRGEFEERLKGAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDE
1cr0A           ESVEETAEDLIGLHNRVRLRQSDSLKREI--------IENGKFDQWFDELFGNDTFHLYD--SFAEAETD
1g6oA           IVFKHHKNYTQLFFGGNI-TSADCLKSCLRXRPDRI----ILGELRSSEAYDFYNVLCSGHKGTLTTLHA
1a4iA2          ----------------------------------------------------------------------
2fggA1          ------------------------------------------HVGKTCQIDVLIEEHDERTRAKARLSWA
1v47A1          ----------------------------------------------------------------------
1q12A1          ----------------------------------------------------------------------
1bccF           -LEGIRKWYYNAAFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQILPK---EQ
3cddA1          ---------------------------------------AGVSLILGDNVKAARGRFSWRQRFSKFTIKA
1zs3A1          DEKYAKELDKAEIDHHKPTAGAMHVLSNLFIEIRLTQAGIAKSPVKCEYLREIAQREVEYFFKISDLLLD
1l7lA           DQGLICHD---AFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAI--TLIYNDVPGT-----YGNNSGS
1esmA           QALLSRWPEHRRVELITTDGFLHPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNVTAPVYSHL
1e3mA2          EIGP--------IDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANK
1vhhA           ------------------------------------KLTPLAYKQFIPNVAKTLGASGRYEGK--ITRNS
1np6A           HELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLA--------------SRMDTSKLDLILVEGFKHE
2qgmA1          -------------------------------------------QSVQKNIVK--SIQSQANPLKTIEPSK
1ovmA2          TAAQQRGELLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACIDRVLTTMLRERRP--------------
1em8A           ----------------------------------------------------------------------
1atrA1          IGDAAKNQVAMVVQSDMKHWPFMVVNDAGRPKVQVEYKGVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDS
1qhdA1          TDLITNYSPSREDNLQRVFT-VASIRSML-----------------------------------------
2vgmA3          -----------------------------------------KEIMVMDEFLLHLNKDD-------DKAWY
1viaA           FNQKEQKRENFFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKAFEYLKKRLDKDEISKRPLFYDEIK
1poiA           GNGRVKAYINCYTANSGVTNVSRRFRKWFEAGLTMEDYSQDVIYMMWHAAPVTLMQGSGLTDEWGISKEV
1lw7A2          EKLGG--DEQAMQYSDY-------------PQXALGHQRYIDYAVRHSHKIAFIDTDFITTQAFCIQYEG
1iqrA2          -----------------------------------RGDLRLHDHPALLEALARGPVVGLVVLDPNNLKTT
1gm5A1          ----------------SSLFLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLENKDLEEK
1f2t.1          DAILESAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGK--------ERPLTFLSGG
1q3tA           EALLALLDQHPISFGRSETGDQLVFVGDVDITHPIRE---NEVTNHVSAIAAIPEVREKLVSLQQEI-AQ
1ni3A1          EEAKVAVPDERFDWLCEAYKPKSRVPAFLTVFIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDDA
1xl3C1          -----------------AYDLSEFMGDIVALVDXRWAGIHDSLPTPEIXVRFYQDLXRMFRLFPLGVFSD
2pa7A1          -----------KKIIDRGSLVAIEENKNIPFSIK-------RVYYIFDTKGEEPRGFHAHKKLLVCLNGS
3cddA2          VDDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQG
1uouA3          ----------------------------------------------------------------------
1b77A2          VEDSGLTRSLTLTDYDGNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVYVIAMEADSTHD--
1o7d.2          -----------------------------------------------------------ERFQVIVYNPL
1ckeA           DALVPLASHLDVRFVSTNGNLEVILEGEDVS----GEIRTQEVANAASQVAAFPRVREALLRRQRAFREL
2ancF1          TDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAHYAEYDYLIVNDDFDTALT
1ckvA           IEVDCDEELLGRQFNVYDFLVDVSSTIGRAYTLGNKFTITSELMG-------------------------
1ii8.1          ------------ALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPGERIALG
1t9hA2          SSLEIEEEELGYTFPDIREKSSSCKFRGCLHLKEPK--------CAVKQAVEDGELKQYRYDHYVEFMTE
1iioA           --------------------------SHMKMGVK------EDIRGQIIGALAGADFNGPDTTCKSELKAS
1mkyA1          VDTCGVFDNPQDIISQKXKEVTLNXIREADLVLFVGKRGITKEDESLADFLRKSTVDTILVANKAENLRE
2gtlM1          LGDDDHVPSSLFVCAHFNAQRY------------------------------------------------
3d31A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1puoA2          -DVFFAVANGNELLLDLSLTKNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKD---------
1zbsA1          --------------------------EGIACILGTGSNSCLFDGREI--KANVSPLGYILGDEGSGAVLG
1f8xA           --------------------------------------------------------------GAGWFTDR
1d8jA           --------------------------------------------AKIVNYMKTRHQRTLDLDETQHLDIG
1e2hA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGE----------AGSPP
1tueA           WLEPLTDTKV--AMLDDATTTCWTYFDTYMRNALDGNP--ISIDPLIQLKCPPILLTTNIHPAKDNRWPY
1yr6A1          VKELPYEPSIDFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLF
1yvuA2          DFVKRELLKKXIPSQVILNRTLKNVLLNVAEQVLAKTGNIYKLKEIEGKVDAFVGIDISR------ITRD
2vnuD1          ----------------------------------------------------------------------
1l1oA           LEISGIVEVVGRVTAKA----TILCTSYVQFKEDSHPFDLGLYNEAVKIIHDF--PQFYP----------
1w1wA           DGKTVSYKDYSIFLENFLVFQGVELSRMFTFDYVSDHLDAIYRELTGNASLTKYHATLKRFKDMEYLSGG
1oxsC1          ----------------------------------------------------------------------
2gujA1          DSAKIASEEVPFTFEDFDVPEKL-----------------------------------------------
1yj5A2          RCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGNFCATIEQARHNNRFREXTDPSHAPVSDXVX
1g8fA3          N----NKTELLSLIQDFIGSGSGLIIPDQWEDLESADEPISHIVQKVVLFLEDNGFFVF-----------
1jqjA3          FNVSYVLDVLNALKCENVRM-MLTDSVSSVQIEDAASQSAAYVVMPM-----------------------
2bsqE1          -----------------ASVVIRNLSEATHNAIKFGRSTEAEIRLILDNIAKAQQTVRLGSMLGQEIGGV
1odfA           THE--DQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVV----LPKYD-------KSQFKG
1v37A           --------------------------------------------LRARRTAELAGFSPRLYPELREIHFG
1pgsA2          FQHQLGALGCSANPINNQSP-GNWTPDRAG----WCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNG
1g2914          ----------------------------------------------------------------------
2je6I3          LIEAIRKI--------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1heiB1          ITYSTYGKFLADGGCSGGAYDIIICDECHSTDA-------------------------------------
1v43A2          ----------------------------------------------------------------------
1oa8A           ---------------------------DLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVG
1p5zB           QMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYINLYESECMNETEWTIY
1jqjA2          --------------------------SEVEFTLP------QATMKRLIEATQFSMLNGMLEGEELRTVAT
1tf7A1          QDIIKNARSFGWDLAKLVDEGKLFILD------------------ASPDPEGQEVVGGFDLSALIERINY
1g2913          ----------------------------------------------------------------------
1j90A           ELMYKDPKKWAMPFQSYVTLTMLQSH--TAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQG--MYNTL
1l8qA2          GTINEFRKSVDLLLLDDVQFLSGKERTQIEFFHIFNTLYLLEKQIILASDRHPQKLDGVSDGILVEIELD
4tmkA           GGTQLAEKLRSLLLDIKSVGDE--VITDKAEVLMFYAARVQLVETVIKPALTWVIGDRHDLSTQAYQGGG
1e6vC           -------------------------------------------------------------------YMN
2bdtA1          DELLALTWKNITDLTVFLLAQNDVVLDYIAFPDEAE----------------------------------


                         +         .         .         .         .         *         .:210
query           QRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELRSLQKKLGITFIFITHDQEEALAMSDEIFVL
1b0uA           QQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVVTHEMGFARHVSSHVIFL
1sgwA           TIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREE----LSYCDVNENL
1m3eA1          KDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKA--DQAGNVTFRKSARNFNLPXCKAAETTVV
1l7vC           EWQRVRLAAVVLPAGQLLLLDEPXNSLDVAQQSALDKILSALCQQ-GLAIVXSSHDLNHTLRHAHRAWLL
1q3hA           QRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM--ANKTRILVTSKMEHLRKADKILIL
1ji0A           EQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQE-GTTILLVEQNALGALKVAHYGYVL
1e69A           EKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSK--HTQFIVITHNK-IVMEAADLLHGV
1t06A           LKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTVAPLHEKAVEIAKEVGIV
1mukA           DVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHL----------NTDIPPRMGWLRAILRFL
1ex6A           AIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYDKVIVNDDLDKAYKELKDFIFA
1e9rA           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
1pf4A1          QRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALD--ELQKNKTVLVIAHRL-STIEQADEILVV
1nijA1          FFSHEVLCQRYLLDGVIALVDAVHADEQ----MNQFTIAQSQVGYADRILLTKTDVAGEAEKLHERLARI
2yyeA2          DNWKLILLSDPVTSGGLLFTINKEKLE----------KIDETAKELEVNYGETIAENVLEV---------
1khbA1          EWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALS---WQHGVFV
1urjA           QRLASVMAGDAALASMAVFDEPPTDISAWDTAAARANAVGAYLARAAGLVGAMVFSTNSALHL-------
1jjvA           TAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQ---IQRIMNSQVSQQERLKWADDVINN
1bmfA3          YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGD--VSAYIPTNVISI
1ohcA1          QRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYDAAYGSCNFYITLLDCFHAVKKAMQYG------
1qhlA           HSLMFDLLRSASDRSKFYRLIEAYGGISSAITRSLRDYLL------------------------------
1j1zA2          RLSPAALLQ----RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQ
1pv4A3          RAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEG------GSLTIIATALIDTGSKXDEVIYEEFKGT
1ffhA2          LQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDAGGAALSARHV
1mjgM           NYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGLTDETVDTFYAPNHVCIV
1jalA1          INTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSYNFL
1grqA           LDVLWVG-----VRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHK-ESIECAWAI---
2iqhA1          VAHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFR-------LLQNSQVYSLIRPNENPAHKSQLVWMA
2gx8A1          LDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEKVMKVQKQLQEK
1vplA           SKRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQE-GLTILVSSHNMLEVEFLCDRIALI
1mm8A           AMQTVKLAQ----EFPELLAIEDTTSLSY--RHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGL
1n25A           FVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLS
1rkbA           DNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWI------------------------
1g6hA           QMKLVEIGRALMTNPKMIVMDEPIAGVAPGLA-HDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM
1bgxT2          APTPEDFPRQLALIKELVDLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVL
2gk3A1          NRYDVIVISDIGSNTFLLQNETFYQLKIKPNALES---IKEYVKNGGGLLXIGGYLSFXGIEAKANYKNT
2v3jA1          KVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKL------DDDESICVFVGAGKDNFADEYVDEKVGL
1s9hA           NSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQ---EVKDFFRWAKDHVVEVEHEFYVKKG--------
1dhyA1          SAGDAALYRADQRAWRIAVQPGELDDLAYALEVDDAAALERMADKLRQAGVAFTRGDEA--LMQQRKVMG
1xbtA1          ILNLVPLAESVV----------------------------------------------------------
1kgdA           KVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVEL
1dnpA2          PRQAELINAQLNLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVER
1jb1A           RNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIE----------------------------------
1f46A           FKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN------------------------
2axpA1          IDSILELYREVXSNAGLHTYSWDTGQWS---SDEIAKDIIFL----------------------------
1afrA           YTSFQERATFISHGNTARQAKEHGDIKLAQICGTIA-------ADEKRHETAYTKIVEKLFEIDPDGTVL
1udwA           DVVLFEGILAF-YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCL
1bs2A1          ERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKT-HEPTTVVTYLFKL---THQVSSCY
1i1qA           VLRAIATAH-------------------------------------------------------------
1t3wA           LNHXFDSLLEL--RQEELIARERTHGLSNEERLELWTLNQELAK--------------------------
1g8yA           LKRAAEGRRLMVLDTLRRFHIEEENASGPM-AQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSYLSSM
1tljA           NQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLAR-GKQKMNLLKD---LLS--------
1es6A2          EVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS-------------------
1e6cA           GRPIAEEMEAVLREREALYQDVAHYVVDTQPPAAIVCELMQTMR--------------------------
1zp6A1          ERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQ-SAINALQSGRFRI---------
1d6jA           EETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVKQIIDYLDTKGY----------------------
1fl9A           TNLGKNIISAF-----------------------------------------------------------
1c4oA1          IYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEI---LKEIEKELRVRYFEERG---------------
1sbxA           RCEGETISCFVVGGEKRL---CLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGIPFSA
2f9hA1          NLQSIAHSTLIFADAPTDEDDVIRNGVYLTP-------HQLPKITIGTTIDYL-----------------
1tmkA           DLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEK---------VKQTFMKLLDKEIRKGDESITIV
1cd5A           VNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIK-GL----------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          IPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAA---
1l3aA           RSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENIYIPVAEFAVLVSA---------------
1jbkA           YRQYIEKDAALERRFQKVFVAEPSVEDT------------------------------------------
1cr0A           RLLAKLAYMRSGLGCDVIILDHISI---RKMIDNLMTKLKGFAKSTGVVLVVICHDLRALRQLSDTIIAL
1g6oA           GSSEEAFIRLANXSKFESLIEGFKDLID------------------------------------------
1a4iA2          --------------PAEILNGKEI---SAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINV
2fggA1          GRQXVGVGLARLDPA-----DEPVAQIG------DELAIARALSDLANQLFALTSSDIEAS---------
1v47A1          --PALEIGEDERLDL-ENLATGAFFPVKGFMTREEALSVAHEMRLPTVWTIPILLQFREKPRPGNTVALL
1q12A1          --------------------------------------------------------------------NF
1bccF           WTKYEEDVPYLEPYLKEVI---------------------------------------------------
3cddA1          AKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQTGKLWNINTLVPVI
1zs3A1          ENEIVPSTTEEFLKYHKFITEDPKAKYW-----TDEDLLESFIVDFQAQNMFITRAIKLANKEEKF----
1l7lA           FSVNIGKDQS------------------------------------------------------------
1esmA           IYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDP-HHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKF
1e3mA2          IKALTLFA----------THYFELTQLPEKXEGVANVHLDALEHGDTIAFXHSVASKSYGLAVAALA---
1vhhA           ERFKELTPNY---NPDIIFKDEENTGADRLMTQRCKDKLNASVMNQWPGVKLRVTEGWDEDGHHSEESLH
1np6A           EIAKIVLFRDGAGHRPEELVIDRHVIAVASVPLNLDVALLDINDVEGLADFVVEWMQKQ-----------
2qgmA1          PFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFR-LVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTG
1ovmA2          ----------------------------------------------------------------------
1em8A           -------------NATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWAR
1atrA1          QRQATKDAGTIAGLNVLRIINEPTAAAIAYGL--------------------------------------
1qhdA1          ----------------------------------------------------------------------
2vgmA3          GEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSV-ESNGGKALVLSTLHSLGEELDQLTGI-
1viaA           AKKLYNERLSKYEQKANFILNIENKNIDELLSEIKKV---------------------------------
1poiA           RKTLDKVPDDKFKYIDNPFKP-------------------------------------------------
1lw7A2          KAHPFLDSXIKEYPFDVTILLKN--NTEQKQRQQFQQLLKKLLDKYKVPYIEI-----------------
1iqrA2          PRRRAWFLENVR------ALREAYRARGGALWVLPWEKVPEAARRLKAKAVYALTSHTPYGRYRDGRVR-
1gm5A1          LQAFLDYVKEIP------NLPEARKRYRIQKSLEMIEKLRSWF---LIDYL-------------------
1f2t.1          ERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKK-IPQVILVSHD-EELKDAADHVIRI
1q3tA           QGGIVMDGRDIG---TVVLPQAELKILVASVDERAERRYKENIAKG----IETDLETLKK----------
1ni3A1          EIIHVEGDVDPI--RDLSIIVDELLIKDAEFVEKHLEGLRKITSRGANTLEXKAKKEEQAIIEKVYQYLT
1xl3C1          EEQRQNLLQMCQNAIDMAIEEEELSELD------------------------------------------
2pa7A1          CRVILDDGNI----IQEITLDSPAVGLY--VGPAVWHEMHDFSSD-CVMMVLASDYYDETDYIRQYDNFK
3cddA2          ETPHELLARLAK-QRGVLLTSDTFGNLV------------------------------------------
1uouA3          -------------------------------EELLAPADGTVELVRALPLALVLHELGALRLGVGAELLV
1b77A2          ----------------------------------------------------------------------
1o7d.2          GRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFS--ALVPAVGFS-IYSVSQMPRDLVI
1ckeA           PGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLD
2ancF1          DLKTIIRAERLRMSRQKQRHDALISKLL------------------------------------------
1ckvA           ----------------------------------------------------------------------
1ii8.1          LAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKL-ITIMERYLKKIPQVILVSHDEE-LKDAADHVIRI
1t9hA2          IKDR------------------------------------------------------------------
1iioA           DAGQVLTADDFPFSAEEVADTIVNKA--------------------------------------------
1mkyA1          FEREVKPELYSLGFGEPIPLDTXLETIIKKLEEKGLDL--------------------------------
2gtlM1          ----------------------------------------------------------------------
3d31A1          ----------------------------------------------------------------------
1g31A           -------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGEVPELCVVHSVGPPEGFCEVGDLTSL
1puoA2          ----------------------------------------------------------------------
1zbsA1          RLFIGSLLKGQXPEG---LCEAFLQEYGLTSADIIESVYRKPFPN---RFLAGFSPFIAQHLDIPAVYSL
1f8xA           QNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNG-IKTNDIMLGV
1d8jA           LKQKQWLMEALVNNPKIEVIDGKYAFKPKYNV--------------------------------------
1e2hA           PALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPG
1tueA           LESRITVFEF----PNAFPFDKNGNPVYEINDKNWKCFFERTWSRL------------------------
1yr6A1          HEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTDLLSEEEKERHRKYFEDIDYL
1yvuA2          GKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGD---------VFSLL-EKLGFKKGSKIVVH
2vnuD1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1w1wA           EKTVAALALLFAINSPFFVLDEVDAALDITNVQRIAAYIRRHRNP-DLQFIVISL-KNTMFEKSDALV--
1oxsC1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1yj5A2          FSYRKQFEPPTLAEGFLEILEIPFRLQE-----HLDPALQRLYRQF------------------------
1g8fA3          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
2bsqE1          ELEDVR----------------------------------------------------------------
1odfA           EGDRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENNDL-------------------------------
1v37A           ALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHG--------------
1pgsA2          TN---GDAFYAISSFVIAK---------------------------------------------------
1g2914          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1dwmA           -------------------------------GNMAAATVERENRN-VHAIVLKEGSAMTKDFRCDRVWVI
1heiB1          ----------------------------------------------------------------------
1v43A2          ----------------------------------------------------------------------
1oa8A           EHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQL-FDLPCSKLSVGDVCISLTL---------------
1p5zB           QDWHDWMNNQFGQSLELDGPETCLHRIYLRGRNEEQGILEKLHYKHESWLLHRTLKTNFDYLQEVPILTL
1jqjA2          DGHRLAVCSMPIGQS----LPSHSVIVPRKGVIELMRMLDGGDNP---LRVQIGSNN-------------
1tf7A1          AIQKYRARRVSIDSVTSVFQQYDAS---SVVRRELFRLVARL-KQIGATTVMTTERIEEYGPIAR-----
1g2913          ----------------------------------------------------------------------
1j90A           EEWYKFIEESIHVQADLIIY---LRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDQRRPQSCKVL
1l8qA2          NKTRFKIIKEKLKEFNLELRKEVIDYL-------------------------------------------
4tmkA           RGIDQHMLATL-----------------------------------------------------------
1e6vC           PNYELKKLREIPDEDIVRLMGHREPGEEYPSV--------------------------------------
2bdtA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NNGNIVQSGTPVDIYDEPINHYVADFIGESNIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPE
1b0uA           HQGKIEEEGDPEQVFGNPQSPRLQQFLKGS----------------------------------------
1sgwA           HKY-------------------------------------------------------------------
1m3eA1          EVEEIVDIGSFAPEDIHIPKIYVHRLVK------------------------------------------
1l7vC           KGGKXLASGRREEVLTPP----------------------------------------------------
1q3hA           HQGSSYFYGTFSELQ-SLRPDFSSKLMGYDT---------------------------------------
1ji0A           ETGQIVLEGKASELLDNE----------------------------------------------------
1e69A           TMVNGVSAIVPVEV--------------------------------------------------------
1t06A           EVKRDN----KKSSLLNASESIQKELDRGRLGFKR-----------------------------------
1mukA           GAGMVMTATGVADIYLEDI---------------------------------------------------
1ex6A           E---------------------------------------------------------------------
1e9rA           RSWLEDPNGGNLFITWREDMGPALRPLI------------------------------------------
1pf4A1          DEGEIIERGRHAD---------------------------------------------------------
1nijA1          NARAPVYTVTLGLLFNTNGFMLEENVVSTKPRFHFI----------------------------------
2yyeA2          ----------------------------------------------------------------------
1khbA1          GAAMRSEAKIIMHDPFAMRPFF------------------------------------------------
1urjA           ----------------------------------------------------------------------
1jjvA           DAELAQNLPHLQQKVLELHQFYLQQAENKN----------------------------------------
1bmfA3          TDGQIFLETELFYKGIRP----------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1j1zA2          RDMLSPKYAELVYYWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRAPKSLYRQDLVSFGYDQK
1pv4A3          GNXELHLSRKIAEKRVFP----------------------------------------------------
1ffhA2          TGKPIYFAGLEPFYPERLAGRIL-----------------------------------------------
1mjgM           TPERVGLCGAVSWLDAKASYEINHAGP-NQPIPKEGEIDPIKGIWKS-----------------------
1jalA1          TLKPTMYIANVNEPYLDRVREIAAKEGAVVVPVCA-AIESEIAELDDEEKVEFLQDLGIEEPLNRVIR--
1grqA           ----------------------------------------------------------------------
2iqhA1          CHSAAFEDLRVSSFIRGTKVVPRGKL--------------------------------------------
2gx8A1          VDAKKLNVHIHASLHTDPFIF-------------------------------------------------
1vplA           HNGTIVETGTVEELKERYKAQNIEEVFEE-----------------------------------------
1mm8A           LHQEWWMRPDDPADADEKESGKWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSK
1n25A           VYQKMKF---------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1g6hA           FNGQIIAEGRGEEEIKNVLSDVVEIYIGE-----------------------------------------
1bgxT2          HPEGYL--ITPAWLWEK-----------------------------------------------------
2gk3A1          VLAEVLPVIXLDGDDRVEKPEGICAE--------------------------------------------
2v3jA1          SNYPLSASVACSKFCHG-----------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1dhyA1          LLCLQDPFGLPLEIYYGPAEIFHEPFLP------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1dnpA2          ALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLREGMPECVAAPKVRSSG--SIEPSPSI
1jb1A           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1afrA           AFADMMRKKISMPAHLMYDGRD------------------------------------------------
1udwA           PTKKYADVIIPRGADNLVAINLIVQHIQD-----------------------------------------
1bs2A1          DVLWVAGQTEELATARLALYGAARQVLYNGMRLLGLTPVERM----------------------------
1i1qA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1g8yA           TSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWF---------------------------------
1tljA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1sbxA           PSCGLITKTDAERLCNALLY--------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1tmkA           DVTNKGIQEVEALIW-QIVEPVLSTHID------------------------------------------
1cd5A           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1cr0A           ERNQLVLVRILKCRFTGDTG--------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1a4iA2          KLKAAEEIGIKATHIKLPRTTTESEVMKYIT----SLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPE
2fggA1          ----------------------------------------------------------------------
1v47A1          HGGERVALLHVAEAYE------------------------------------------------------
1q12A1          LPVKVTATAIDQVQVELPMPNRQQVWLPVESR-----------------------DVQVGANMSLGIRPE
1bccF           ----------------------------------------------------------------------
3cddA1          DEIXGLDEE-------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1esmA           REGAFTDPDSYFHNYAKLTKEEAIKTAXTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLR--
1e3mA2          ----------------------------------------------------------------------
1vhhA           YEGRAVDITTSDRDRSKYGMLARLAVEAGFDWV-------------------------------------
1np6A           ----------------------------------------------------------------------
2qgmA1          KGNPREFLKLLYPTDEIIAXIEWXKDYNADP---------------------------------------
1ovmA2          ----------------------------------------------------------------------
1em8A           PAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILIRTSFADFATA----------------------
1atrA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f2t.1          SLEN------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1ni3A1          ETKQPIRKGDWSNREVEIINSL------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2pa7A1          KYIAKI----------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1uouA3          DVGQRLRRGTPWLRDGPALSGPQSRALQEAL---------------------------------------
1b77A2          ----------------------------------------------------------------------
1o7d.2          QNEYFDPNTGLLMELENLL-------LLPVRQAFYWYNASTGNNLSSQASGAYIFRPNQNKPLFVSHWAQ
1ckeA           STT-----LSIEQVIEKALQYA------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1ii8.1          SLENGSSKVEVV----------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
3d31A1          ------------------------------NVLKGRVISAERIRVGEVVID-AAGDMEVGDQVYAFLRPE
1g31A           PVGQIRNVPHP-----------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1zbsA1          VQNSFDDFLVRNVLRYNRPDLP-LHFIGSVAFHYREVLSSVIKKRG------------------------
1f8xA           YIPDEEDVGLGMELGYALSQGK------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2hA           ERLDLAMLAAIRRVYGLLAN--------------------------------------------------
1tueA           ----------------------------------------------------------------------
1yr6A1          TA-RLKLDPSMQGLMAYKMCSMMTEVLPPVRVL-------------------------------------
1yvuA2          RDGRLYR---------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1oxsC1          ----------------------------EINELEGKV-TNEGVVIGSLRFPVSVSS----DRAIIGIRPE
2gujA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
2bsqE1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1g2914          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1dwmA           VNDHGVVTSVPH----------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1v43A2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1p5zB           DV-----NEDFKDKYESLVEK-------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------
1g2913          ------------------------------NFLDAIVTEDGFVDFGEFRLKLLPDQFEVGREVIFGIRPE
1j90A           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DLVLTSPEKGQLKVKVDTQLFRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRxxxxx
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1j1zA2          DAE-------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1mm8A           HPRKDVESGLYLYDHLKNQPELGGYQISIPQKGVVDKRGKR-----------------------------
1n25A           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1dnpA2          TLNYPRQS--------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1a4iA2          KDV-------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1q12A1          HLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLQNDVVLVEEGATFAIGLPPERCHLF------
1bccF           ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1o7d.2          THL----VKASLVQEVHQNFSAWCSQVVRLYP--------------------------------------
1ckeA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
3d31A1          NIALSSSIRNSLQGRVTEAWVLGALVRVKVDCGVPLNVLIAEEMELSPGVQIYARFKASSVHVLR-----
1g31A           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1oxsC1          DVKLSKDVIKVGKGKVKVIGYQGGLFRITITPLDSEEIFTYSDHPIHSGEEVLVYVRKDKIKVF------
2gujA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
2bsqE1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1g2914          ---VRVPGENLVRAVVEIVENLGSERIVRLVGGVTFVGSFRSESRVREGVEVDVVFDMKKIHIF------
2je6I3          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1v43A2          -----MKRTARLIGKVDFVEALGTDTILHVKFGDELKVKLPGHIPIEPGREVKVIMDLDMIHVF------
1oa8A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------
1g2913          DLYDAMFAQ-------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxx
1b0uA           ------------
1sgwA           ------------
1m3eA1          ------------
1l7vC           ------------
1q3hA           ------------
1ji0A           ------------
1e69A           ------------
1t06A           ------------
1mukA           ------------
1ex6A           ------------
1e9rA           ------------
1pf4A1          ------------
1nijA1          ------------
2yyeA2          ------------
1khbA1          ------------
1urjA           ------------
1jjvA           ------------
1bmfA3          ------------
1ohcA1          ------------
1qhlA           ------------
1j1zA2          ------------
1pv4A3          ------------
1ffhA2          ------------
1mjgM           ------------
1jalA1          ------------
1grqA           ------------
2iqhA1          ------------
2gx8A1          ------------
1vplA           ------------
1mm8A           ------------
1n25A           ------------
1rkbA           ------------
1g6hA           ------------
1bgxT2          ------------
2gk3A1          ------------
2v3jA1          ------------
1s9hA           ------------
1dhyA1          ------------
1xbtA1          ------------
1kgdA           ------------
1dnpA2          ------------
1jb1A           ------------
1f46A           ------------
2axpA1          ------------
1afrA           ------------
1udwA           ------------
1bs2A1          ------------
1i1qA           ------------
1t3wA           ------------
1g8yA           ------------
1tljA           ------------
1es6A2          ------------
1e6cA           ------------
1zp6A1          ------------
1d6jA           ------------
1fl9A           ------------
1c4oA1          ------------
1sbxA           ------------
2f9hA1          ------------
1tmkA           ------------
1cd5A           ------------
1mi8A           ------------
1ak2A1          ------------
1l3aA           ------------
1jbkA           ------------
1cr0A           ------------
1g6oA           ------------
1a4iA2          ------------
2fggA1          ------------
1v47A1          ------------
1q12A1          ------------
1bccF           ------------
3cddA1          ------------
1zs3A1          ------------
1l7lA           ------------
1esmA           ------------
1e3mA2          ------------
1vhhA           ------------
1np6A           ------------
2qgmA1          ------------
1ovmA2          ------------
1em8A           ------------
1atrA1          ------------
1qhdA1          ------------
2vgmA3          ------------
1viaA           ------------
1poiA           ------------
1lw7A2          ------------
1iqrA2          ------------
1gm5A1          ------------
1f2t.1          ------------
1q3tA           ------------
1ni3A1          ------------
1xl3C1          ------------
2pa7A1          ------------
3cddA2          ------------
1uouA3          ------------
1b77A2          ------------
1o7d.2          ------------
1ckeA           ------------
2ancF1          ------------
1ckvA           ------------
1ii8.1          ------------
1t9hA2          ------------
1iioA           ------------
1mkyA1          ------------
2gtlM1          ------------
3d31A1          ------------
1g31A           ------------
1puoA2          ------------
1zbsA1          ------------
1f8xA           ------------
1d8jA           ------------
1e2hA           ------------
1tueA           ------------
1yr6A1          ------------
1yvuA2          ------------
2vnuD1          ------------
1l1oA           ------------
1w1wA           ------------
1oxsC1          ------------
2gujA1          ------------
1yj5A2          ------------
1g8fA3          ------------
1jqjA3          ------------
2bsqE1          ------------
1odfA           ------------
1v37A           ------------
1pgsA2          ------------
1g2914          ------------
2je6I3          ------------
1dwmA           ------------
1heiB1          ------------
1v43A2          ------------
1oa8A           ------------
1p5zB           ------------
1jqjA2          ------------
1tf7A1          ------------
1g2913          ------------
1j90A           ------------
1l8qA2          ------------
4tmkA           ------------
1e6vC           ------------
2bdtA1          ------------